KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_02600Help
Entry
BANAN_02600       CDS       T02047                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BANAN_02600
   00051 Fructose and mannose metabolism
    BANAN_02600
Enzymes [BR:bni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BANAN_02600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622568..623920
Genome map
AA seq 450 aa AA seqDB search
MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRFGVAWWHTFDAPLTDP
FGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHDRDIAPEGDTLRETNAN
LDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFADVYAYAAAQLKHSLEIGK
RLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYAKQIGMDAQFLIEPKAKEP
TTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTYQHEIRVARDNGVLGSLDAN
QGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNFDAKPRRTSFSAEDLFRAHI
AGMDTFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSIDDGTATLESLNDYAIDMPQ
SEIIASTHPDHLEDVKATINNYIIDALANA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtctgtgggacatcgacaagatcgagtatgtcggccgcaccaagggtcttcag
gagggactcggattccagtattacgatgccgacaaggttgtcgccggcaagaagatgaag
gactggctgcgcttcggtgtggcatggtggcacaccttcgacgcgccgctcaccgacccc
ttcggcgatggcaccgcccagcgcccgtgggacggcaagtactccgacccgatggacaac
gcgctcgccaaggtggactacgcgttcgagttcttcaccaagctcggcgccgagtacttc
tgcttccatgaccgcgacatcgccccggaaggcgatacgctgcgtgagacgaacgccaac
ctcgaccgcgtggtcgacaagatcgaagagaacatgcagtccaccggcgtgaagctgctg
tggaacacctcgtcgctcttcaccaacccgcgcttcgtggcaggcgcctccacctcgccg
ttcgccgacgtctacgcctatgccgcggcgcagctcaagcactccctcgagatcggcaag
cgcctgggcgccgagaactacgtgttctggggcggccgcgaaggctacgagaacctgtgg
gtcaccgacatgaagcgtgagcaggagcacatggcgaagttcttccacatgtgcgccgac
tacgccaagcagatcggcatggacgcccagttcctcatcgagccgaaggccaaggaaccg
acgacgcaccagtacgacttcgacgcggctacggcatgcaacttcctgcgcgcctatgac
ctgatcgacgtcttcaagctcaacctcgaaggcaaccacgccaacctcgcaggccacacc
taccagcacgagatccgcgtcgcccgcgacaacggcgtgctcggttcgctcgacgccaac
cagggcgacatgctgctcggctgggacctcgatgagttcccgaccaacctgtacgagacc
acctccgtgatgtgggaagtgctcgacgaaggccagatcggccctcacggcggcctcaac
ttcgacgccaagccgcgccgcacctcgttcagcgctgaagacctgttccgcgcgcacatc
gccggcatggacacgtttgccgccggcctgctcgtggcggacaagatgcatcaggacaag
tacatcgaggaccttgtggccaaccgttatggctcctacgattcgggcatcggcaagtcg
atcgacgacggcaccgccaccctcgagtcgctcaatgactacgccatcgacatgccgcag
tccgagatcatcgcatccacgcaccccgatcacctcgaggacgtgaaggcgaccatcaac
aactacatcatcgacgccctggccaacgcctga

DBGET integrated database retrieval system