KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_03435Help
Entry
BANAN_03435       CDS       T02047                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BANAN_03435
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAN_03435
   00520 Amino sugar and nucleotide sugar metabolism
    BANAN_03435
Enzymes [BR:bni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BANAN_03435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820433..821203
Genome map
AA seq 256 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEHSTPKAVGDIVRQQLEHFEV
PEDVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QAFGAAAGQEGLVIATTLGTGIGTALIYDGVLIPNTELGHIQLPKGKGDAEKYAASSVRE
KLDMGYKKWAKRLTKYYGLMELYFSPELFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIVGAAYYASQQSAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcattcggcgttgacatcggtggctcgggcatcaaggccgcc
ccggtgaatctggagaagggcgaattcgccgaaccccgcctgaagatcctcacccccgag
cactccactcccaaggccgtgggagatatcgtgcgccagcagctcgagcatttcgaagtg
cccgaggacgtgccggtgggcattgcgttcccggctccgatcaagccgggcaagaagctc
gacttcatggcgaacctcgatcagtcgtggattggtgtggacgtgaccgaggtgttctcg
gaggcatgcggtcgcccggtcaccgtggtcaacgacgcggacgcggccggtctggcggaa
caggcgttcggtgcggcggcaggccaggaggggcttgtcatcgccaccaccctcggcacc
ggtatcggcaccgctctgatctacgatggcgtgctcatccccaacaccgagctcggccac
atccaactgccgaagggcaagggcgatgcggagaagtatgcggcatcttcggtccgtgaa
aagctcgacatgggctataagaagtgggccaagcgcctcaccaagtactacggtctcatg
gagctgtacttcagccccgagttgttcgtggtcggcggtggtgtgagccgcgtctccgag
aagttcctgccgtacatcgacatcaaaaccccgatcgtcgccgccaagctgcataacgag
gcgggcatcgtgggtgccgcctactacgccagccagcagtcggccaagtaa

DBGET integrated database retrieval system