KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_03660Help
Entry
BANAN_03660       CDS       T02047                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BANAN_03660
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BANAN_03660
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BANAN_03660
Enzymes [BR:bni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BANAN_03660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(876882..878369)
Genome map
AA seq 495 aa AA seqDB search
MSTFHSTRSSDEAFTSKQAIRKGIADDGGLFVTDALGETKIDISDLAGKSYQQIALKVLS
VLLDDYTEEELSQCIAEAYGSQWSDERITPVKPLGDDFIMELFNGPTCAFKDVALQILPR
LMARTTPADGDRDERIMIVTATSGDTGKAALAGFADAQGTGITVFYPQGKVSRVQELQMT
TQQGSNVNVCAVDGNFDDAQSTVKRIFGDRDLASRLEADAHVRLSSANSINVGRLVPQVV
YYFSAYAQLLEQQVINVGDQVDFVVPTGNFGNVLAGYYAKLLGLPVRQLVVASDRNNVLF
DFLTTGTYNSKRPFFETTSPSMDILVSSNLERMLYYMSERDPRMITYLMNDLAEWGTYEV
PPEMLMEIRKVFATGWADEDQVREMIADCWDRNHYVIDPHTACGYFVMQQMPADPQVPRV
LLSTASPYKFPRVVNEALGLKADGTDFECMDELHAKSGTQIPQMLRNLENAEVRFRDCVE
VSDMSHYVEECADRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttccatagcacacgcagcagcgacgaggcattcacatccaagcaggcgata
cgcaagggcatcgccgacgatggcggtctgttcgtcaccgatgcccttggggagacgaag
attgacatcagcgatcttgcgggtaaaagctatcagcagattgctttgaaggtgttgtcg
gtgctgcttgacgactacaccgaggaggagctctcccagtgcatcgccgaggcatacggc
tcccaatggagcgatgagcgcatcactccggtcaaaccgctgggcgacgacttcatcatg
gaattgttcaacgggccgacctgtgcgttcaaggacgtcgcgttgcagatccttccccgg
ctgatggcccgcaccactccggcggacggggatcgcgatgagaggatcatgattgtcacc
gcgacctccggggataccggcaaggcggcgcttgccggattcgcggatgcgcagggcacc
ggcatcacggtgttctatccgcagggcaaggtctcccgcgttcaggaactgcagatgacc
acgcaacaggggtccaatgtgaacgtatgcgcggtggatggcaatttcgatgatgcccag
tccacggtcaaacgcatcttcggcgaccgtgatctcgcgtcacgccttgaggcggacgcg
catgttcgcctttcctctgcgaattcaatcaatgtggggcgtctcgtaccgcaggtcgtc
tattatttctccgcttacgcacagctgcttgaacagcaggtgatcaacgtgggcgaccag
gtggacttcgtggtgcccaccggtaatttcggcaatgtgcttgccggatattacgccaaa
ctgctgggcctgccggtacgtcaactcgtcgtcgcctccgaccgcaacaatgtgctcttc
gacttcctcaccaccggcacctacaacagcaagcggccgttcttcgagaccacgtcgccg
tccatggacattctcgtctcctcgaatctggagcgcatgctctactacatgagcgagagg
gatccgcgtatgatcacctatctcatgaacgatctcgccgaatggggaacctacgaggtg
cctccggagatgctcatggagattcgcaaggtgttcgccaccggttgggccgatgaggat
caggtgcgcgagatgatcgccgactgctgggatcgcaaccactatgtgattgacccgcat
accgcatgcggttatttcgtgatgcagcagatgccagcggatccgcaggtgcctcgtgtg
ctgctgtccactgccagcccgtacaagttcccgcgcgtggtcaatgaggcgcttgggctg
aaggcggatggcaccgatttcgaatgcatggacgaattgcacgccaaatcgggcacgcag
attccgcagatgctgcggaatctggagaatgccgaggtgcggttccgcgactgcgtcgag
gtgagcgacatgagccactacgtcgaggaatgcgccgaccggctatag

DBGET integrated database retrieval system