KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_03695Help
Entry
BANAN_03695       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
Enzymes [BR:bni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BANAN_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFI62953
Position
884298..885002
Genome map
AA seq 234 aa AA seqDB search
MEPYARHVTLVRHGRTSYNRQGLVQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQ
LVVSSDLERSMQTAHAFADRLGLEVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCR
GMGGEMNHGAESHEHAGARGMEAMNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRY
PDFISLTSMRNAHWARLRRADIDMDNRWIMEDYNHGPALADTQYWERPDTLPAK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgtacgcacgccatgtcacgctggtgcgccatggccgcacctcatacaacaga
caagggctggtgcagggatcgatcgacattccgctcgatgaggtcgggctgtggcaggtg
aaccagtccgcgcagtcactgattaagctatatgtgctcccggacccatcacggcaccag
ctcgttgtgtcctccgacctcgaacgttcgatgcagacggcacatgccttcgccgatcga
ctggggctcgaagtgcatgccgacgaacggttgcgcgagcggcatttcggtgaattcgaa
ggccgatccggcgcatacctgcaggccaatttcccgcaggacttcgactcgtggtgccgg
ggcatgggcggcgagatgaatcatggcgccgaatcccacgaacatgccggtgcccgcggc
atggaggccatgaatgattgggcccatgaatgcgatgacgacaccgacctgttcgtattc
tcccatggcgcgctcatcgaaaacgcgctgcaggtgctgttcggcatcgaacgacgatac
ccggatttcatctcgctcacctcgatgcgcaacgcgcactgggccagactgagaagggcc
gatatcgacatggacaaccggtggatcatggaggactacaaccatggacccgccctggcc
gatacacagtattgggaacgcccagacaccttgccagcgaaatga

DBGET integrated database retrieval system