KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_03695Help
Entry
BANAN_03695       CDS       T02047                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BANAN_03695
   01230 Biosynthesis of amino acids
    BANAN_03695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAN_03695
  Energy metabolism
   00680 Methane metabolism
    BANAN_03695
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BANAN_03695
Enzymes [BR:bni01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BANAN_03695
Exosome [BR:bni04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BANAN_03695
  Exosomal proteins of melanoma cells
   BANAN_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884298..885002
Genome map
AA seq 234 aa AA seqDB search
MEPYARHVTLVRHGRTSYNRQGLVQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQ
LVVSSDLERSMQTAHAFADRLGLEVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCR
GMGGEMNHGAESHEHAGARGMEAMNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRY
PDFISLTSMRNAHWARLRRADIDMDNRWIMEDYNHGPALADTQYWERPDTLPAK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgtacgcacgccatgtcacgctggtgcgccatggccgcacctcatacaacaga
caagggctggtgcagggatcgatcgacattccgctcgatgaggtcgggctgtggcaggtg
aaccagtccgcgcagtcactgattaagctatatgtgctcccggacccatcacggcaccag
ctcgttgtgtcctccgacctcgaacgttcgatgcagacggcacatgccttcgccgatcga
ctggggctcgaagtgcatgccgacgaacggttgcgcgagcggcatttcggtgaattcgaa
ggccgatccggcgcatacctgcaggccaatttcccgcaggacttcgactcgtggtgccgg
ggcatgggcggcgagatgaatcatggcgccgaatcccacgaacatgccggtgcccgcggc
atggaggccatgaatgattgggcccatgaatgcgatgacgacaccgacctgttcgtattc
tcccatggcgcgctcatcgaaaacgcgctgcaggtgctgttcggcatcgaacgacgatac
ccggatttcatctcgctcacctcgatgcgcaacgcgcactgggccagactgagaagggcc
gatatcgacatggacaaccggtggatcatggaggactacaaccatggacccgccctggcc
gatacacagtattgggaacgcccagacaccttgccagcgaaatga

DBGET integrated database retrieval system