KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_03900Help
Entry
BANAN_03900       CDS       T02047                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta (EC:4.1.1.48)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BANAN_03900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BANAN_03900
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BANAN_03900
Enzymes [BR:bni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BANAN_03900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
923944..926028
Genome map
AA seq 694 aa AA seqDB search
MSVLDELVAGALEDKCDRERVTSLEELKARVALAPAPLDAKRWLRRPDGIPVIAEIKRAS
PSKGHLIDIEDPATLARQYEQGGASAISVLTEGRRFLGSLDDVDAVRAAVHIPVLRKDFI
TTDYQIWEARAHGADIVLLIVAALDDTQLAHLLKLTHELGMTALVETHTREEIERAIAAG
ARVIGINARNLKDLRVDVGKYTELASNLPEDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDPRLAVERLVKAGERVKASETTPLSEHHGPYWGQFGGRYVPEALITALDELQR
VYDDAKDDPEFHKELATLNKRYVGRPSPLTEAPRFAERIKERTGLDARVFLKREDLNHTG
AHKINNAIGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPEMVRDF
QKIIGEEAKEQLAQWYGIDHPDAICACVGGGSNAIGIMNAFLDDPRVNLYGFEAGGHGPN
SGQHAIRFASGTGELGMFQGAKSYLLENSEGQTLDTYSISAGLDYASVGPEHAWLKEIGR
VNYSWATDEEAMSAFKDLCETEGIIPAIESSHAVAGAYKAARDLKEKGYEHPVMIVNISG
RGDKDMNTAGKWFGYLTDEQAAALEANGATGNNA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggatgaactggtagcgggggcactcgaagacaagtgcgaccgtgaacgc
gtaacgtcgttggaagagctcaaggcccgggttgccttggctccggctcccctcgacgcg
aaacgatggcttaggcgtcccgacggtattccggtgattgccgaaataaagcgtgcctcg
ccgtcgaaagggcatctcatcgatatagaagaccccgccactttggcccgacaatacgaa
caaggcggtgcgagcgcaatctcggtgctcactgagggccgcaggttcctcgggtctctt
gacgatgtcgatgccgtacgtgccgccgtgcacatcccggtgcttcggaaggatttcatc
accacggattaccagatctgggaggcgcgtgcgcatggagcggatatcgtgctgctcatc
gtcgcggcgctcgacgacacacagctggcgcatctgctgaagctcacgcatgaactcggt
atgaccgccctggtcgaaacgcatacccgtgaggaaatcgagcgggccatcgcggccggc
gcgcgtgtgatcggcatcaatgcgcgcaatctgaaggatttgcgtgtcgatgtgggcaaa
tacaccgagctggcgagcaatctgcccgaagatgtgatcaaggtggccgagtccggtgta
ttcggcgccgttgaagttgaggattatgcccgcgccggagccgacgctgttctggtagga
gagggcgtggccaccgccgatgacccgcggctggccgtggaacgattagtgaaggcagga
gaacgcgtgaaagcttctgaaaccaccccattgagcgaacatcatggcccgtattggggg
cagttcggcggccgctatgtgccggaggcgcttatcaccgccctcgatgaattgcagcgt
gtgtacgacgacgcgaaagatgatcccgaattccacaaggagctcgccacactcaataag
cgctatgttggacggccttcaccgctcaccgaggcgccgcgattcgccgaacgcatcaag
gaacgcaccggactcgacgctagagtgttcctcaagcgcgaggacctcaaccacactggt
gcccataagatcaataatgcgatcgggcaggcactgctcgtcaaacgcatgggcaagacc
cgcgtgatcgcggagaccggagcaggacagcacggcgttgctacagccaccgtgtgtgcg
atgctcggcctcaagtgccgcatctacatggggcagatcgacgcacggcggcaggcgctc
aatgtggcacgcatgcgcatgctgggagccgaggtggtcgaagtgacgctcggcgatcgc
attctcaaggacgccatcaacgaggcgctgcgtgattgggtcaccaacgtcaaagacacc
cactatctgcttggtaccgtcgcaggtcctcatccattcccggagatggtgcgtgacttc
cagaagatcataggtgaggaggcaaaggagcagctggcacagtggtacggcatcgatcat
cccgatgcaatctgcgcctgcgtgggcggtggctccaatgccattggcatcatgaacgcc
ttcctcgacgatccgcgcgtcaacctctatggtttcgaggctggcggccatgggccgaac
tccggccagcatgccatccgtttcgcatctggaaccggtgaactcggcatgttccagggg
gccaaaagctacctgcttgagaactctgagggacagacccttgacacctactcgatttct
gcaggcctcgactatgcgtccgttggccctgaacatgcatggctcaaggaaatcggacgc
gtgaactattcatgggcgaccgatgaggaagcgatgagcgcgttcaaggatctgtgcgag
accgaaggcatcattccagctatcgagagctcccatgccgtcgccggcgcctataaagcg
gcgcgggatctcaaggagaagggctatgagcatccggtgatgattgtgaacatctccgga
cgcggcgacaaggacatgaacaccgccggcaaatggttcggatatctcaccgacgagcag
gcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtga

DBGET integrated database retrieval system