KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_03905Help
Entry
BANAN_03905       CDS       T02047                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BANAN_03905 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BANAN_03905 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BANAN_03905 (trpA)
Enzymes [BR:bni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BANAN_03905 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926054..926923
Genome map
AA seq 289 aa AA seqDB search
MTEYNTTPSGQPLGISHRLSPCRELFTRFKAQNKPAFIGYLPFGFPTMEQSLEAFATMVE
NGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVETVANAGGVPLIMSYWN
LIYHYGVEHFAADFANAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSTDERLR
VVCENDRGFVYAASRMGVTGERSSLGTSPEDLVARTHKAGAENVCVGIGVSTAAQGKAVG
QYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELAEGIHNARL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatacaacaccacgccaagcgggcagccgctcggaatcagccatcgtctcagc
ccatgccgcgagctgttcacacggttcaaagcgcagaacaagcctgcgttcattggatac
ctgccattcggattccccacgatggaacagtcacttgaggccttcgccacgatggtcgag
aacggtgccgacatcgtcgagataggactgccgtattccgatccagtgatggacggcccg
gtgatccaggccgccagccagatcgccctgaacaatggcgagcgcatagccgatgtgttc
aaagccgtggaaacggtggccaacgccggtggagtgccgctcatcatgagttattggaac
ctcatctaccattatggggtcgaacactttgccgctgatttcgcgaatgcaggaggcgca
ggccttatcacccccgatctcattcccgacgaggcgggggagtggatcgaggcgtctgac
cgccatgggctcgatcgcatcttccttgtttcccccgactccaccgatgagcgtctgcgg
gtggtgtgcgaaaacgaccgaggattcgtctatgcggcatcgcgcatgggcgtgactggt
gaacggtcgagtctggggacttccccggaggacctcgtggcccggacccacaaggcgggg
gccgagaatgtgtgcgtgggcatcggcgtctccaccgccgctcaaggcaaggccgtcggg
cagtatgcagacggggtcatcgttggatccgccttggtccacacactgctcaccgaggac
ggcgatgcacgtgagctcacctcaggtctggctgcattggcggccaagaccgcagaactc
gccgagggaatccacaacgcccgcctgtag

DBGET integrated database retrieval system