KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04000Help
Entry
BANAN_04000       CDS       T02047                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BANAN_04000
   00052 Galactose metabolism
    BANAN_04000
   00500 Starch and sucrose metabolism
    BANAN_04000
   00520 Amino sugar and nucleotide sugar metabolism
    BANAN_04000
Enzymes [BR:bni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BANAN_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(942130..943557)
Genome map
AA seq 475 aa AA seqDB search
MTDAFERTAEKMKAHGLSETAIAQFEHLYDVWKHEDGTTWIREEDIEPVQDIPNFAQIYE
TINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKAKQMRFIDIILGQVETAR
NRLGVKLPLTFMNSFRTSSDTMKVLNRDKRFHQEDVPMEIIQHVEPKIDLSTGAPVSFPA
NPDLEWCPPGHGDLYSTLWESGLLDILESHGFKYLFISNSDNLGARPSRTLAQHFENTGA
PFMIEVSKRTEADRKGGHIVRDKVTGRLMLREMTQVAPEDAAEAKNIAKHPYFNTNNIWV
RIDSLREKLAQSNGVLPLPVIRNYKTVDPTDASTTKVIQLETAMGAAVSLFNGAICVEVD
RMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPNVQLDTRFYKNIHDFDDRFPYGV
PSLAAAASVTVEGDWTFGRDVNFYGEATLHDEGRPSYVPNGEFVGPQGIEPDEWL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcgagcgaaccgccgagaagatgaaggcccatggcctgagcgagacg
gccatagcccaattcgagcatctctatgatgtgtggaagcacgaggacggcaccacttgg
attcgcgaggaggacatcgagccggttcaggacattcccaatttcgcgcagatctatgag
acgatcaaccacgacaaggcggtcgacgcattcgccaagacggcgttcctcaagctcaac
ggcggtctgggaacctcaatggggctcgactgcgcaaaatcattattgccggttcgcagg
cacaaggccaagcaaatgcgcttcatcgacatcattctcggacaggtggaaaccgcacgc
aaccgactgggcgtgaagctcccgctgacgttcatgaactcgttccgcacatcgtccgac
accatgaaggtgctcaaccgagacaagcggttccatcaggaggatgttccgatggagatc
atccagcacgtggagcccaagatcgacctctccacaggggcgccggtatcattccccgcc
aatcccgatctcgaatggtgcccaccgggacacggcgacctgtattcgaccctatgggaa
tcgggtctgctcgacattctcgaaagccacggattcaagtacctgttcatctcgaactcc
gacaatctgggtgcacgcccgtcacgcactctggcccagcacttcgaaaacaccggcgct
ccgttcatgatcgaagtgtcgaaacgtaccgaagcggatcgcaagggtggtcacatcgtt
cgcgacaaggtcaccggtaggctcatgctgcgtgagatgacgcaggtggctcccgaagac
gcggcggaagccaagaacatcgccaagcatccgtatttcaatacgaacaacatctgggtg
cgcatcgactccctacgcgagaaactggcacagagcaacggcgtgcttccattgcctgtc
attcgcaattacaagaccgtcgacccaacggatgcctccaccaccaaggtgattcagctc
gagaccgcgatgggcgctgcggtgagtctgttcaacggggcaatctgcgtcgaggtggac
cgcatgcgcttcctgccggtaaaaaccaccgacgatctgttcatcatgcgctccgaccgc
ttccatctgactgatcagtacgagatggaggacggcaactacatcttcccgaacgtccag
cttgacacgcgcttctataagaacatccatgatttcgacgaccggttcccctatggcgtg
ccatcgctcgcagcggctgcctcggtcacggtggagggggattggaccttcggccgcgat
gtgaacttctatggtgaggcgacattgcatgatgagggacggccgagttatgtcccaaac
ggcgaattcgtgggaccgcagggtatagagcccgacgaatggctgtag

DBGET integrated database retrieval system