KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04205Help
Entry
BANAN_04205       CDS       T02047                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00010  Glycolysis / Gluconeogenesis
bni00051  Fructose and mannose metabolism
bni00562  Inositol phosphate metabolism
bni01100  Metabolic pathways
bni01110  Biosynthesis of secondary metabolites
bni01120  Microbial metabolism in diverse environments
bni01130  Biosynthesis of antibiotics
bni01200  Carbon metabolism
bni01230  Biosynthesis of amino acids
Module
bni_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAN_04205 (tpiA)
   00051 Fructose and mannose metabolism
    BANAN_04205 (tpiA)
   00562 Inositol phosphate metabolism
    BANAN_04205 (tpiA)
Enzymes [BR:bni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BANAN_04205 (tpiA)
Exosome [BR:bni04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BANAN_04205 (tpiA)
  Exosomal proteins of bladder cancer cells
   BANAN_04205 (tpiA)
  Exosomal proteins of melanoma cells
   BANAN_04205 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFI63053
Position
complement(985681..986493)
Genome map
AA seq 270 aa AA seqDB search
MASTRRIPMVAGNWKMNFDHLEATGFVRAFSKNLKRCHFDFNRCEVALFPSFTSIRSVQV
MVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSYVIVGHSERRKYHPEDDANIV
DQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDVTRDLSDGEASKLIIAYEPVW
AIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLYGGSVSSKNCVELIEEPDVDG
FLIGGAALDVDELTTICRKTIATTSSHDNG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcaaccgggttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaaccgttgcgaagtggcgctcttcccgtcattcacctcgattcgcagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccgatcctatgcgtcggcgagagt
ctggaggagagacgcaagggcattgaacttgagtttgccgtcggccaggtgcatgacgtg
acacgcgacctttctgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgccaccccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcatttggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccagacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatggttga

DBGET integrated database retrieval system