KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04205Help
Entry
BANAN_04205       CDS       T02047                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BANAN_04205 (tpiA)
   01230 Biosynthesis of amino acids
    BANAN_04205 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAN_04205 (tpiA)
   00051 Fructose and mannose metabolism
    BANAN_04205 (tpiA)
   00562 Inositol phosphate metabolism
    BANAN_04205 (tpiA)
Enzymes [BR:bni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BANAN_04205 (tpiA)
Exosome [BR:bni04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BANAN_04205 (tpiA)
  Exosomal proteins of bladder cancer cells
   BANAN_04205 (tpiA)
  Exosomal proteins of melanoma cells
   BANAN_04205 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(985681..986493)
Genome map
AA seq 270 aa AA seqDB search
MASTRRIPMVAGNWKMNFDHLEATGFVRAFSKNLKRCHFDFNRCEVALFPSFTSIRSVQV
MVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSYVIVGHSERRKYHPEDDANIV
DQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDVTRDLSDGEASKLIIAYEPVW
AIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLYGGSVSSKNCVELIEEPDVDG
FLIGGAALDVDELTTICRKTIATTSSHDNG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcaaccgggttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaaccgttgcgaagtggcgctcttcccgtcattcacctcgattcgcagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccgatcctatgcgtcggcgagagt
ctggaggagagacgcaagggcattgaacttgagtttgccgtcggccaggtgcatgacgtg
acacgcgacctttctgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgccaccccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcatttggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccagacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatggttga

DBGET integrated database retrieval system