KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04395Help
Entry
BANAN_04395       CDS       T02047                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bni00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bni00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1037221..1038180)
Genome map
AA seq 319 aa AA seqDB search
MGTSVITLDDLTVTQIEELLHKAQYIDSHRKEVAHTCDGRVLATLFYEPSTRTRLSFETA
MLRLGGKVIGFAGSQLSSATKGESISDTLKTVSNYVDVVAIRHPKEGAALVAADASSVPV
INAGDGGHMHPTQTLADLATLQSRFGRVNGLTIGLCGDLTFGRTVHSLIETLCRFGNVRF
VLISPKELRTPQYVLNRINATPTCSYEEVTDLSSVIGDLDALYMTRVQKERFFNEDDYLR
LRDTYILDEGKLAKAKPTMAVLHPLPRVNEIATEVDADPRAAYFEQVKNGMLMRMALESS
VLGDELPGYEQYANQEVEA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaccagcgtcatcaccctcgacgatctcacagtcacgcaaatcgaggagttgctg
cataaagcgcagtacatcgattcgcatcgcaaggaagtggcacacacctgtgacggacgg
gtgttggccactttgttttatgagccgagcacgcgcacacgactgagcttcgagaccgcg
atgctgcggttgggcggcaaggtgatcggtttcgcgggatcgcagctgagctccgcgacg
aagggcgagtcgatttcggacacgttgaagaccgtgtcgaactacgtcgacgtcgtggcg
atccgccacccgaaggaaggcgccgccctggtggccgcagacgcctcctcggtgccggtg
atcaacgccggcgacggcggccacatgcacccgacgcagacgctcgccgacctcgcgacg
ctgcagtcgcgattcggacgggtgaacggcctgacgatcggcctgtgcggcgacctgacc
ttcggccgcaccgtgcactcactcatcgagacgctgtgccgctttggcaacgtgcgtttc
gtgctcatctcaccgaaagagctgcgcaccccgcaatatgtgctcaaccgcatcaacgcc
acgcccacctgctcgtacgaggaggtcaccgacttgagttcggtcataggagatctggac
gccctgtacatgacgcgcgtgcagaaggaacgcttcttcaacgaagacgattacctgcgc
ctgcgtgacacctacattctcgacgagggtaaactcgcgaaggccaagcctacgatggcg
gtgctgcacccgttgccgcgcgtcaacgaaatcgccacggaggtggacgccgacccccgt
gccgcctatttcgaacaggtgaagaacggcatgctcatgcgcatggcattggaaagctcg
gtgctcggcgacgaattgcccggctacgagcagtatgcgaaccaggaggtcgaagcctga

DBGET integrated database retrieval system