KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04795Help
Entry
BANAN_04795       CDS       T02047                                 

Gene name
guaA
Definition
(GenBank) GMP synthase
  KO
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BANAN_04795 (guaA)
Enzymes [BR:bni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     BANAN_04795 (guaA)
Peptidases [BR:bni01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   BANAN_04795 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1125540..1127102)
Genome map
AA seq 520 aa AA seqDB search
MAAGPVLVVDFGAQYAQLIARRVREANVYSELVPHSMPVEEMLAKKPSAIILSGGPASVY
EPGAPTIDKSIFTAGVPVLGICYGFQVMAHELGGDVDKAALGEYGKTEAVVDDATGILDG
SPSLQTTWMSHGVAVNKAPAGFEVTAHTEGAPVAAMEDPSRKLYGVQWHPEVKHTPLGQD
LIENFLHDCAGIEADWNARNIIDEQVAAIREKVGDAQVICGLSGGVDSAVAAALVHRAIG
DQLTCVFVDHGLLRKGEAEQVKHDFVAATGIKLIAVDASKDFLDALKGVSDPETKRKIIG
EKFIRTFEKAQRQVIEEAGAQGKEVKFLVQGTLYPDVVESGGGDGASNIKSHHNVGGLPD
DLKFELIEPLRSLFKDEVRAIGTELGLPDEIVWRQPFPGPGLGIRIIGEITKERLDILRD
ADAIAREELSKAGLDRDIWQCPVVLLADVHSVGVQGDERTYGMPIVLRPVSSEDAMTADW
SRVPYDVLATISTRITNECRQINRVVLDCTSKPPATIEWE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaggtcctgtccttgtcgttgatttcggagcgcaatacgcgcagctcatcgcg
cgccgcgtgcgcgaggcgaacgtgtattccgaattggtgcctcattcgatgccggtcgag
gagatgctggccaagaagccgtccgcgatcatactgtcaggcggcccggcgtcggtgtac
gaacccggtgctcctaccattgacaagagcatcttcacggccggagtgccggtgcttggc
atctgctatggcttccaggtgatggcccatgagctcggcggcgacgtcgacaaggcggcg
ctcggcgagtacggcaagacggaagcagtggtggacgatgccacgggcattctcgacggt
tcgccatccctgcagaccacttggatgagccatggtgtcgccgtgaacaaggcacccgcc
ggattcgaagtcaccgcgcataccgaaggggcgccagtggctgcgatggaggatccctca
cgcaagctctacggcgtgcagtggcatcctgaggtcaagcacacgccgctgggacaggat
ctgatcgagaatttcctgcatgattgcgccggcatcgaagccgattggaacgcaaggaac
atcatcgacgagcaggtcgctgcgattcgtgagaaggtcggtgacgcacaggtcatctgt
ggtctgtctggtggagtcgattcggccgtggccgcagcgctcgtgcaccgcgcaatcgga
gaccagctcacctgcgtgttcgtggatcatggtctgctacgcaagggcgaggccgagcag
gtcaaacatgatttcgtcgcggcgaccggcatcaagctcatcgcggtcgatgcctctaag
gacttcctcgatgcgctcaagggcgtctccgatcctgagacgaagcgcaagatcatcggc
gaaaaattcatccgcaccttcgagaaggcgcagcgtcaggtgattgaagaggccggtgcc
cagggcaaggaggtcaagttcctcgtgcagggcacgctctacccggacgtcgtcgaatcc
ggtggcggcgacggcgcctcgaacatcaagtcccaccacaatgtgggcggcctgcccgac
gacctcaagttcgaattgatcgaaccgctgcgttcgctgttcaaggatgaggtgcgcgcg
atcggcaccgagctcggcctgccggacgagatcgtctggcgccagccgttcccgggcccg
ggcctcggcatccgcatcatcggcgagatcacgaaggaacgactcgacattctgcgcgac
gccgacgcgatcgcccgtgaggaactgtcgaaggccggtctggatcgcgacatctggcag
tgcccggtcgtgctgctcgccgacgtgcactccgtgggtgtgcagggtgacgaacgcacg
tacggcatgccgatcgtgctgcgtcccgtgagttccgaggacgcgatgacggccgactgg
tcgcgcgtgccgtacgacgtgctcgcgacgatctcgacgcgcatcacgaacgaatgccgc
cagatcaaccgtgttgtgctcgactgcacgtcgaagccgccggcgacgattgagtgggag
tga

DBGET integrated database retrieval system