KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04820Help
Entry
BANAN_04820       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1129 DUF998
Motif
Other DBs
NCBI-ProteinID: AFI63172
Position
1135097..1136326
Genome map
AA seq 409 aa AA seqDB search
MGRHQRAEASGLISFVICAIIGGFGMYWYMQAASAFWQISQRRFMACAGIVAACGVASFI
AGYLRRRSYNTFRDIWMFHLRRIFEVLALSVVYAFTLFLTSYMLFNVMNGAMGKNVFSTY
IPAICAAFAGVSGYLTFVQAELMDAKTLASLLPFFIISGVCTASFTTNDPYWFNNNFSQL
GDRTTFAARMFNSTLILGGTCIIIISYFAVSELIATYRVKGPHGTVHMRNPHFSYHVPKF
RARIITLSILLVLCGVCFIGIGCFRYTPHPILHNVFARGMPCVMFVMLIGLPWLAPQLSR
SFFVISDLALVVCAVEGVMWLKGHNTLTNVEALAAMLFLGWFIVFSRQIASIEADRIQQQ
LLRRQTVSLDELDADEALDDAAETEFQTVLDENPSIVGNDSKGVPTQRS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtcatcaacgggcagaggcctccggcctcatctcattcgtgatttgcgccatc
ataggcggattcggcatgtattggtacatgcaggcggcttcagccttctggcagatctca
cagcgccggttcatggcctgcgccggaatcgtggcggcctgcggtgtggcctcgttcatc
gccggatatctgcggcgcaggagctacaacacgttccgtgacatttggatgttccatctg
cgtcgcatattcgaggtgctcgccctttccgtcgtctacgccttcacgctcttcctcacc
tcgtacatgctgttcaacgtgatgaacggcgctatgggcaaaaacgtattcagcacttat
attccggccatatgcgcggcattcgctggggtatcgggttacctcacctttgtgcaggcg
gaattgatggatgccaagacgttggcgtctctgctgcccttcttcattatttcgggcgtc
tgcactgcaagcttcaccaccaacgatccctattggttcaacaacaatttctcgcagctg
ggtgaccgtaccacttttgctgcccgtatgttcaactcgacgctcattctgggcggcacc
tgcatcatcatcatcagttacttcgcggtttccgagctcatcgccacctaccgagtgaag
ggtcctcacggcaccgtgcacatgcgcaatccgcatttctcataccatgtgccgaagttc
agggcgcgcatcatcaccttgtccatactgctggtgctgtgtggcgtgtgcttcatcggc
atcggctgcttccgctatacccctcatccgattctgcataatgtgttcgcccgtggcatg
ccgtgcgtgatgttcgtcatgctcatcggactgccttggctggcaccgcagctgtcgaga
tcgttcttcgtcatttccgatctcgccttggtggtctgcgccgtggagggtgtcatgtgg
ctcaaaggtcacaatacgctgacgaatgtggaggcgctggcagccatgctgttccttggc
tggttcatcgtcttctctcggcagatcgcctccattgaggccgaccgcatccagcagcag
ttgctacgcaggcagacagtctcgctcgatgagctcgatgcggatgaggctttggatgac
gccgcggagacggaattccagaccgtgctcgacgagaatcccagcattgtgggcaacgat
tcgaagggtgtaccgacccaacggtcataa

DBGET integrated database retrieval system