KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04865Help
Entry
BANAN_04865       CDS       T02047                                 

Definition
(GenBank) excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bni00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    BANAN_04865
DNA repair and recombination proteins [BR:bni03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BANAN_04865
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BANAN_04865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrB Helicase_C ResIII UVR DEAD AAA_22 AAA_5 AAA_19 UB2H AAA_16 AAA_28 ZapA Pox_A_type_inc
Motif
Other DBs
NCBI-ProteinID: AFI63181
Position
complement(1147705..1149816)
Genome map
AA seq 703 aa AA seqDB search
MGFNIERTNRPFVVKSPYKPSGDQPKAIEELATRIENGENDVVLMGATGTGKTATTAWLI
ERLQRPTLIIEPNKTLAAQLCAEFRELMPDNAVSYFVSYYDYYQPEAYIPQTDTYIEKDS
NINDDVERLRHAATANLLTRRDCVVVATVSCIYGLGTPEEYAGRMLFLHEGDQIDRDDLL
RTFVDMQYKRNDIAFTRGTFRVRGDTVEIIPVYEELAIRIEFFGDEIDRISTLHPLTGDV
IEQVSDVHIFPASHYVAGPERMAKALDSIQRELDERVAELRKQGKELEAQRLSMRTTYDL
EMLSQVGVCSGVENYSRHFDGRAAGTPPHTLLDFFPDDFLLVIDESHVTVPQIGAMYEGD
ASRKRTLVEHGFRLPSAMDNRPLKWPEFLDRVGQTVYLSATPGDYELGLSDGVVEQIIRP
TGLLDPKIDVRPVEGQIDDLLAKIKDRVAAGERTLVTTMTKKMAEDLTDYLLERGIKVEY
LHSDVDTLRRVELLRELREGKIDVIVGINLLREGLDLPEVSLVAILDADKEGFLRSYRSL
IQTIGRAARNVSGTVIMYADEMTDSMSKAIEETNRRREIQMAYNEEHRIDPKPLIKKISD
VNDMLAKEDVDTQELLEGGYRNSGKAGNSHLGLPNTTPEEADRRHEEILKAGLPAQDLAD
LIRQLSDQMHTAAEQLQFELAARLRDEIRDLKKELRAITQAQQ
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgggattcaatatcgaacgcacgaacaggccgtttgtggtcaaatcgccgtacaagccc
tccggagaccagccgaaggccatcgaggagctggccacgcgtatcgagaacggcgagaac
gacgttgtgctgatgggtgctaccggcaccggcaagaccgccaccaccgcatggctcatc
gaacggctgcaacggcccacgctcatcatcgaaccgaacaagacgctcgccgcccagcta
tgtgcagagttccgcgagctcatgccggacaacgcggtgagctacttcgtttcgtactat
gactactaccagcccgaggcctacattccgcagaccgacacctatatcgagaaggattcg
aacatcaacgacgacgtcgagcgtttgcgccacgctgcgaccgcgaatctgctcacacgc
cgcgactgcgtggtcgtggccaccgtgtcctgcatatatggcctgggcacgcccgaagag
tacgccggccgcatgctcttcctgcatgagggggaccagatcgaccgagacgatctgctg
cgcaccttcgtcgacatgcagtacaaacgcaacgacatagcattcacccgcggcacattt
cgggtgcgcggggacacggtggagatcatcccggtgtatgaggagctggccatacgcatc
gagttcttcggcgacgagatcgaccgcatctccacgctgcatccgctcactggcgacgtg
atcgagcaggtcagtgacgtgcacatcttcccggcttcgcactacgttgccggtcccgaa
cgcatggcgaaggcgttggattcgatccagcgcgaactcgacgagcgcgtggccgagctg
cgcaagcagggcaaggagcttgaggcgcaacgtctgagcatgcgtacgacgtacgatctg
gagatgctctcgcaagtgggggtgtgctcgggtgtggagaactattcacgtcatttcgat
ggccgtgcggccggcacgccaccgcacacattgctcgacttcttccccgacgatttcctg
ctggtcatcgacgaatcacacgtgaccgttcctcaaatcggcgccatgtacgaaggtgac
gccagccgcaaacgcacgctggtggagcatgggttccggcttccttcggcaatggacaac
cgtccgctcaaatggccggaattcctcgatcgggtgggccagaccgtctatctgtcggca
acgccgggagattacgagctggggctttcggatggcgtggtcgaacagatcatacgaccc
acaggcctgctcgatccgaagatcgatgtgcgtccggtcgaaggccagatcgatgatctg
ctcgccaaaatcaaagatcgtgtggccgcgggggagcgcacgctcgtcacgacgatgacg
aagaagatggctgaggatctcaccgattacctgctggaacgtggcatcaaggtggaatac
ctgcactccgacgtcgacacgctgcggcgcgttgaactgctgcgcgaactgcgtgagggc
aagatcgacgtcatcgtgggcatcaacctgctgcgtgaagggctggatctgccggaggtg
tcgctcgtggcgatcctcgacgccgacaaggaaggcttcctgcgctcgtaccgatcgctc
atccagaccattggacgtgctgcacgcaatgtgagcggtacggtgatcatgtatgccgat
gagatgacggactcgatgagcaaggcaatcgaggagaccaatcgtcgtcgtgagatccag
atggcgtacaacgaggagcatcgcatcgatcccaagccgctcatcaagaagatcagcgac
gtcaacgacatgctcgccaaggaggacgtggacacgcaggaactgctcgagggcggctac
cgcaattccggcaaggcaggtaactcgcatcttggattgccgaacacgacgcccgaggaa
gccgacaggcgccatgaggagattctcaaggccggccttcccgcgcaggatctcgcagac
cttattcgccagctttccgatcagatgcataccgcggccgaacagctgcaattcgaactg
gcggcgcgcctgcgtgacgagattcgcgacctcaagaaggagctgcgggccatcacacag
gcacagcagtag

DBGET integrated database retrieval system