KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_04935Help
Entry
BANAN_04935       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zincin_1
Motif
Other DBs
NCBI-ProteinID: AFI63195
Position
1163375..1163803
Genome map
AA seq 142 aa AA seqDB search
MIRAPWEEKTYRNRHGRGIRTPPFGRRLPRYRTRSGMFDDMAIAQIRRLNDAWPQLLAPL
QFAVEDVPPSSPAPWETNPRLNSQAFPAAHGIPARVVLYRMPLQSHARSRMDLQLAIRDE
LVLRIAELYGRRPEEIDPQWGM
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgcaccatgggaagagaagacgtaccgcaatcgccacggcagggggatccgc
actcccccattcggccggcgcctaccgcgctaccgcacgcgcagcggcatgttcgacgac
atggcgattgcccagattcgccgtctcaacgatgcttggcctcagctgctggcaccgttg
cagttcgccgtcgaagacgttcccccctcgtcaccggctccttgggagacgaatccgagg
ctcaattctcaggcatttcccgctgcgcatggcattccggcccgtgtggtgctctaccgc
atgccattgcaaagccatgcacggtcccgcatggacctgcagctcgccattcgcgatgaa
ctggtgctgcgcatagcggaactctacggccgcaggccggaggaaatcgacccacagtgg
ggtatgtga

DBGET integrated database retrieval system