KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05055Help
Entry
BANAN_05055       CDS       T02047                                 

Definition
B-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BANAN_05055
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BANAN_05055
Enzymes [BR:bni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BANAN_05055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195113..1196552
Genome map
AA seq 479 aa AA seqDB search
MPRFVKVSARFARSTLLSVASGAPPAAIRACELYNGSSHCRNRGPMIQHNDKPQPNPNRR
MVRIVTTVVVTMAIVAIAIGASVLVRHATDSDTTNAEAAPTSAPSRTSSPAPSTTTSIPQ
TASPAPTTKTDATSDRAKRMVAAMSLDERAGQLVMAALQYGNDPATLQSMIQEQHVGNVI
LMGNWVSGVEGVARATQALQGLNASTGLPGLLIATDQEGGMVQHLSGPGFDAMPSATAQG
QMSLDRLRAAAQDWALPLKQSGLAMNLAPSVDTVTIERAANEPIGALYRDFGLDAQRNGE
HAAAFIEGMHAGGVGSAIKHYPGLGSVRGNTDFTANGIVDDTTTENGTGVNAFTTAIRQG
KPAMVMVSLATYKLIDPNNPAAFSPAIVTDMLRRGAPFDGVVISDSLSAGAVSSIAPQDL
GVRFIDAGGDICCVNAASYTQPILDGIRNRAAADKGFAARVTASAERVVRLKIELGLVQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcttcgtcaaggtgtctgcgcgcttcgcgcgtagcacgctcctcagcgtggca
tccggcgccccaccggcggcaatccgtgcctgcgaactgtacaatggcagcagccattgc
agaaaccgaggacccatgatccagcacaacgacaagccgcagccgaacccgaacagacgc
atggtccggattgtcacgaccgtcgtcgtgacaatggcaatcgtcgccattgcgattggg
gcatccgtactggtccgccatgctaccgattccgacacgacgaatgccgaagccgcaccg
acatcggcccccagccgcacatcatcgccggctcccagcacgaccacttccataccgcag
acggcgtcgcccgcacccaccaccaagacggatgccacctcggatcgggccaaacgcatg
gtggcggcgatgagcctcgacgaacgcgccgggcaactggtgatggccgcattgcaatac
ggcaatgaccccgccaccttgcaatcgatgattcaggagcagcatgtggggaacgtgatc
ctgatgggcaactgggtgagcggcgtcgagggcgtggcgcgtgccacacaggcgctgcag
gggttgaacgcctccaccggattgccggggttgctcatcgccaccgatcaggagggcggc
atggtccagcatctgtcgggaccgggattcgatgcgatgcccagtgccacggctcagggc
cagatgtcactcgaccggctgcgcgcagccgcgcaggattgggcccttcccctcaaacag
tccggtctcgccatgaatctggctccttcggtggacacggtaacgatcgagcgtgccgcc
aatgaaccgatcggtgcgctctaccgtgatttcggcctcgacgcccagcgtaacggcgag
catgctgcagccttcatcgaaggcatgcacgccggcggtgtgggcagtgccatcaagcat
tatccgggattgggatcggtgagaggcaacaccgatttcacggcaaacggcattgtcgac
gacacgacaaccgagaatggcacgggggtgaatgcgttcaccactgcgatccggcagggc
aaacccgccatggtgatggtgtcgctggccacctacaaactcatcgaccccaacaatcct
gcggccttctcccccgccatcgtcaccgacatgctgcgcagaggcgccccgttcgacggc
gtggtgatctcggattccctctcggccggtgccgtgagctcgattgcaccacaggatctg
ggcgtgcggttcattgatgcgggaggggacatctgctgcgtgaacgccgcaagctatacg
cagcccattctggacggcatacgcaaccgcgccgctgcggacaagggtttcgccgccagg
gtcactgcgagtgccgaacgcgtggtcagactgaaaatagagctcggcttggtgcagtga

DBGET integrated database retrieval system