KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05110Help
Entry
BANAN_05110       CDS       T02047                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BANAN_05110
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BANAN_05110
Enzymes [BR:bni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BANAN_05110
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BANAN_05110
Exosome [BR:bni04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BANAN_05110
  Exosomal proteins of colorectal cancer cells
   BANAN_05110
  Exosomal proteins of bladder cancer cells
   BANAN_05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1206683..1208242
Genome map
AA seq 519 aa AA seqDB search
MTEHTTHIPGDSPWVNPLRDPRDLRLPRIAGPCSIVIFGVTGDLARKKLLPAIYDLANRG
LLPPSFGLTGFARRDWTEDHFRQFVKENVQQHCRTHFNEVTWNQLAEGIRFVHGTFEDAD
AFERLSNTVAELDKDRGTRGNHAFYMSIPPRDFPLVAQQLANCGLAKSNGDAWRRVIIEK
PFGHDLASAKELDRVISEVFDPNSVFRIDHYLGKETVQNLLALRFANSMYEPIWNSNYVD
HVQITMAEDIGVEGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPVSFNARDLTDEKTKI
LSAVRLPKDLAAHTARGQYSAGWQGSRPVVGYLEEKGINPDSTTETYAAVRLDIDTRRWA
GVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDSTATQELGKNAIVIRIQPYEGVTIRFGS
KVPGGTTMEVRDVSMDFSYGRSFTESSPEAYERLILDVLLGDPPLFPTTQEVDLSWKILD
PIEDFWSTLGQPQPYRAGTWGPQEAVEMLARDGHRWRMP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacacaacgcacattcccggggactcgccctgggtcaatccgttgcgcgac
ccacgggatctgaggcttccccgcatcgccgggccatgttcgatcgtgatcttcggtgtc
acgggcgatctggctcgcaagaaactgttgccggcgatctacgatctcgcaaaccggggc
ctgctgccgccaagcttcggtctcaccggtttcgcacggcgtgattggacggaggatcat
ttccgtcaattcgtcaaggaaaatgtgcagcagcattgccgcacgcatttcaacgaggtc
acctggaaccagcttgcagagggcatacgtttcgtgcatggcaccttcgaggatgccgat
gcgttcgagcgcctgagcaacacggtggccgaactcgacaaggaccgtggcacacgcggc
aaccatgccttctacatgtcgattccgccccgtgacttcccgctcgtggcgcagcagctc
gccaactgcggtctggccaaatcgaacggcgatgcctggagacgcgtgatcatcgaaaag
ccgttcgggcacgatctggccagcgccaaggagctcgaccgcgtgatctccgaggtgttc
gacccgaactcggtgttccgcatcgaccactacctgggcaaggagaccgtgcagaatctg
ctggcgttgcgcttcgccaactccatgtacgagccgatatggaattcgaactatgtggac
cacgtgcagatcacgatggccgaagacattggcgtggaggggcgagccggttactacgac
ggcattggtgcggcacgcgatgtgatccagaaccatctgctgcagttgctcgcgttgacg
gccatggaggaaccggtttcgttcaacgcgcgtgatctgaccgatgagaagacaaagatt
ctctcggccgtgcgcctgccgaaagaccttgccgcgcataccgctcgcgggcagtattca
gccggctggcagggttcccgtccggttgtgggatatctggaggagaaaggaatcaacccg
gattccaccactgaaacctatgcggccgtcagactcgatatcgacacgcgtcgctgggct
ggcgtcccgttctacctgcgtaccggcaagcgccttggccgtcgcgtgaccgaaattgcg
ctggtgttcaagcgcgccccgcatctgccctttgacagcaccgccacacaggagctcggc
aagaacgccatcgtcattcgcatccagccctatgagggcgtcaccattcgtttcggctcc
aaggttccgggaggcaccaccatggaagtgcgtgacgtctcgatggacttcagctacggc
cgctcgttcaccgaatcgtcacccgaggcttacgagcgcctcatcctcgacgtgctgctg
ggagatccgccgttgttcccgaccacgcaggaagtggacctgtcgtggaagatcctcgac
cccatcgaggatttctggtccacgctcggccaaccacagccctatcgtgccggcacatgg
ggcccccaggaggcggtggagatgcttgcccgtgatggacaccgttggaggatgccatga

DBGET integrated database retrieval system