KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05165Help
Entry
BANAN_05165       CDS       T02047                                 

Definition
(GenBank) putative purine or uracil permease
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1222449..1223780
Genome map
AA seq 443 aa AA seqDB search
MFTWTLHGNGKTLKPGEIVEPKERLTWPRTIGIGAQHVVAMFGATFLVPILTGFDPSTTL
FFTAFSTALFLLINKNLLPSYLGSSFGFIAPIAAVASAGKGIAVASFGILCTGLLLAIIG
FVVQWAGAIWIDRIMPPVVNGAIVAIIGFNLAPNVWTNFKAAPDTALVTLVAVLLIAVLF
KGLIGRLNILLGVLIGYAYACIRGQVDFQAIEQAAWVGFPKFHLPQVDFTILPMFLPVVL
VLIAENVGHVKSVAQMTGHDYDNQIGTALIADGLGTTVAGFGGGSGTTTYGENIGVMAAT
KVYSTAAYWCAAGFAFLLSLCPKFGQVVNSIPVGVLGGVTCLLYGMIGMIGVQIWVDNKV
DFAKPINIMTASVVMIVGIANFEFNVNGIQFNGIAIGSIIVLVLYHGMCAIGRATGTIVK
EAPEPTPQERKFENLDEPIDPTR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttcacatggacgctccatgggaacggaaaaacactcaagcccggcgagatcgtcgaa
ccgaaggagcgcctcacctggccccgcaccatcggtatcggcgcacagcatgtggtggcc
atgttcggagccacattcctggtcccgatcctcacaggcttcgacccgtcgaccacgctg
ttcttcacggcgttctccacggcgctcttcctgctcatcaacaagaacctgctgccatcg
tatctgggttccagcttcggcttcatcgccccgatcgcagccgtggcgagcgccggcaag
ggcatcgccgtcgcatccttcggcatcctgtgcacaggcctgctgcttgcgatcatcggc
ttcgtcgtccaatgggcgggagcgatttggatcgaccgcatcatgccccctgtggtcaac
ggcgccatcgtggccatcatcggcttcaatctggctccgaatgtatggaccaatttcaag
gcggcccccgacaccgcattggtcacgcttgtcgccgtcctgctcattgccgtgctgttc
aagggactcatcggccgtctcaatattctcctcggcgtgctcatcggctatgcctatgcc
tgcattcgcgggcaggtcgacttccaggccatcgaacaggccgcctgggtcggcttcccg
aagttccacctgccgcaggtcgacttcacgattctgccgatgttcctgcctgtcgtgctc
gtgctcatcgccgagaacgtcggccacgtgaagtccgtagcgcagatgaccggccatgac
tacgacaaccaaatcggcaccgccctcatcgccgatggtttgggcacgacggtcgccggc
ttcggcggtggttcgggcaccaccacctatggcgagaacatcggcgtcatggcggccacc
aaggtctactccactgccgcatactggtgtgccgcgggcttcgccttcctcctctcgctc
tgcccgaagttcggccaagtagtcaactcgattccggtcggcgtgctcggcggcgtcaca
tgcctgctctacggcatgatcggcatgatcggcgtgcagatctgggtggacaacaaggtc
gacttcgccaagccgatcaacatcatgaccgcctccgtcgtcatgatcgtcggcatcgcg
aacttcgagttcaatgtgaacggcatccagttcaacggcatcgccatcggctccatcatc
gtgctcgtgctctaccatggcatgtgcgcgattggacgcgccaccgggaccattgtcaag
gaggctccggagcccacaccacaggagcgcaagttcgagaatctcgacgagccaatcgat
ccgacgcgctga

DBGET integrated database retrieval system