KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_05755Help
Entry
BANAN_05755       CDS       T02047                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BANAN_05755 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BANAN_05755 (murE)
Enzymes [BR:bni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BANAN_05755 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368654..1370204
Genome map
AA seq 516 aa AA seqDB search
MSLSLQSAARELFAENLLHEIITPHMWTMNAASVENSEVPFTAITYDTRTVTPGTLLVCK
GNFNPKYLEQANKLGMAAYVATNDYSAYTNAPGLIVSDDKKALSILAQAYYDHPERQLTL
IGITGTKGKTTTAYYTHAIINALSGNTTALFSSVDNCVDGMHYVESDLTTPESLDAVRMM
REAVSNGMKYLVMEVSSQAYKVNRVYDFHFDVAAFLNISPDHISPIEHPSFEDYLWCKRQ
IIRNADMLVLGERSDHEQLLLEDAELNRVPVSTFALADSPAQADIADVTCAPTNTEHTAF
DYFVDGERLGSLTLAMEGDFNYANAAAALAIARDAGMDVSDPRALASLADVRISGRMEEM
RDSRSNTLAIVDYAHNFASVNALLDFVEQRYGAEHPHITLITGSAGNKAYDRREGIVKAA
QDRVQKLILTAEDTDTEPIEQICSEMANNVTNEDLDVQTILERAEAVKHAVDEARAADGG
LNILLLIGKGDEQWIKDRNIHTPYEGDSQIIRRLFA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtcgttgcaatccgcagcacgcgagctcttcgcagagaatctgctgcatgag
atcatcaccccacacatgtggaccatgaacgcggcctccgtagagaacagcgaggtgccg
ttcacggcaatcacctacgacacgcgcacggtgacgccaggcactctgctcgtgtgcaaa
gggaacttcaatccgaaatacctcgagcaggcgaacaagctcggcatggcagcgtacgtg
gcgacgaacgattattcggcgtacacgaacgcgcccgggctcatcgtctccgacgacaag
aaagcactcagcattctcgcccaggcatactacgaccacccggagcgtcagctcacactg
atcggcatcactggcaccaagggcaagaccaccaccgcgtactacacgcacgccatcatc
aacgcgctgagtggaaacacgacggcattgttctcgtcggtggacaactgcgtggacggc
atgcactacgtggaatccgacctcacgacgcccgaatcgctcgacgcggtgcgcatgatg
cgcgaggcggtgagcaacggcatgaaatacctggtgatggaggtctcctcacaggcatac
aaagtcaaccgcgtctacgatttccatttcgacgtcgccgcgttcctcaacatctccccc
gatcacatcagtcccatcgagcaccccagtttcgaggactacctgtggtgcaagcggcaa
atcatacgcaatgccgacatgctcgtgctcggcgagcgcagcgaccacgagcaactgctg
ctcgaggatgccgaactgaaccgcgtgcccgtctccacgttcgcattggccgattcgccg
gcacaggccgacattgcggacgtcacctgcgcaccgaccaatacggagcacacggcattc
gactacttcgtggacggcgagcgtctcggcagcctcacgctcgcgatggagggcgacttc
aattatgcgaacgcggccgccgctctggcaatcgcgcgtgacgccggcatggatgtgagc
gacccgcgtgcgctcgcctcactcgccgacgtacgcatctcgggacgcatggaggagatg
cgcgacagcaggtcgaacacgctcgccatcgtcgactacgcgcacaatttcgcctcggtg
aacgcgctgctcgatttcgtggagcagcggtacggcgccgagcatccgcatatcacgctg
atcaccggttcggccggcaacaaggcatacgaccgtcgcgagggaatcgtcaaagccgca
caggaccgcgtgcagaagctcattctcactgcggaggacaccgacaccgagcccatcgag
caaatctgcagcgagatggcaaacaacgtgacgaacgaggatctcgatgtgcagacgatc
ctcgagcgtgccgaagccgtgaagcatgccgtcgacgaggcgcgtgcggcggacggtggc
ctgaacatcctgctgctcataggtaagggcgacgagcagtggatcaaggaccgcaacatc
cacacgccatacgagggcgactcgcagattatccgacgtctgttcgcctga

DBGET integrated database retrieval system