KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_06350Help
Entry
BANAN_06350       CDS       T02047                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BANAN_06350
Enzymes [BR:bni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BANAN_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1516245..1517366)
Genome map
AA seq 373 aa AA seqDB search
MRHTGQAGLAARVARIAMALAIGMAVGMTGACGSEPETPSTATNQPAASEEKSANSGKQS
AEPSEQPTNSATVVPLHVKGAKLLDEQNHPRQLRGVSTHGIAWFPQYVNAELFGNLKREW
GINTVRLAMYTGEEGGYTTNGNKEELRKLVHQGVDAAIKQDLYVIVDWHTLSDNNPLASV
DAAKRFFDEMSHDYAGKPNVIYEICNEPNGTTWAQVKQYAEQIIPVIRANDKNALILVGT
PNWCQNIGEAEADPITGAGNLMYTMHFYAAEHHEELRNAMVSAVENGFPVFVSEFGLTQA
SGDGAIDTASAQAWLNAMDEHDISYVIWNLSNKNEGSALFVTGETRNPQTSDLSAEAKWY
RGYLKQHATEANR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatacgggacaagcgggtttggcggcacgtgtcgcacgcattgcgatggcgctt
gcaatcggcatggcggtgggtatgacgggagcatgcggaagcgagccggagacgccgtcg
acggcgaccaatcaacccgcagcaagcgaggagaagtctgcaaatagtggcaagcagagc
gcggagccgagcgaacagcccacgaactcggccaccgtggtgccgctgcacgtcaagggt
gcgaagctgctcgacgagcagaatcatccccggcagctgcgcggcgtctccacccatggc
atcgcatggttcccgcagtatgtgaacgccgaactgttcggcaatctcaaacgggagtgg
ggaatcaacacggtgcgcctcgccatgtacaccggcgaggagggcggctataccaccaac
ggcaacaaggaggagctgcgcaagctcgtgcaccaaggtgtggatgccgcgatcaagcag
gacctctacgtgattgtggactggcacaccctgtccgacaacaatccgctcgccagcgtc
gatgcagcgaagcggttcttcgacgagatgtcgcacgactatgccggcaagccgaatgtg
atctacgagatctgcaatgaacccaacggcaccacgtgggcgcaggtgaagcagtacgcg
gagcagatcattccggtgatccgagccaacgacaagaacgcactgattctcgtgggcacg
ccgaactggtgtcagaacattggggaggccgaggcggacccgatcacgggtgccggcaat
ctcatgtacacgatgcatttctatgcggccgagcatcatgaggaactgcggaatgcaatg
gtctccgccgtggagaacggtttcccggtgttcgtctccgaattcggcctcacgcaggcg
agcggcgacggggcgatcgacacagccagcgcgcaggcgtggctgaacgcgatggacgag
catgacatctcgtatgtgatctggaatctgtcgaacaagaacgagggatctgcgctgttc
gtcaccggtgagaccaggaatccgcagacctccgatctgtcggccgaagcgaaatggtac
cgtggctacctcaagcagcatgcaaccgaggcgaatcgctag

DBGET integrated database retrieval system