KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_06905Help
Entry
BANAN_06905       CDS       T02047                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BANAN_06905
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BANAN_06905
Enzymes [BR:bni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BANAN_06905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1675199..1676629)
Genome map
AA seq 476 aa AA seqDB search
MIQAFSTYANAQGTTLAAAFAPLGNACLRVGRTPESTAHASAPTLSIDTTRVRQPIDGFG
ASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPSDHVSAPYRFVRRFPDR
KLSSLNFTPEMERVLPMVEAANNCALATQSHALNIMASPWSAPWWMKTNLSVLGKRRYTR
ITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDYPQSRWPSMAMTPREQAEF
VARHLRPMLDHAGLDGTRILCWDHNYSTDHYPDGAFVRDMYADSAALAACAGSAWHYYGG
SARTMSRIHDAFPNKGIWVTEASGGDWGPRNFTPALLSLGTAVIDMMNNWARSAVLWNIA
LDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADYYALGHFSKYVPIGSHCVECAL
DHAQGVRAAAFLTPTGTLVAVLANERAESIWVQCEVDDSGIGVRLPSRSLTTVLRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcattctcaacatacgcgaatgcgcagggcaccacgctcgccgccgcgttc
gcgccgcttgggaatgcctgtttgcgtgtgggacgcactccggagagcacggcacacgcc
agcgcccccacgctcagcatcgacacgactcgcgtgcgccagcccatcgacggcttcggc
gcatcgatcaccgaggcgacgagctggctgtggcacaatcgcgtcacagacaaagagcga
tgcatccgcgatctgttcagcccgcgcgacggcataggcatctcgatgctccgtcagcca
atcggcccgagcgaccatgtgagcgcgccgtaccgcttcgtgcgcagattccccgaccgc
aagctcagctccctcaatttcacgcccgagatggagcgcgtgttgcccatggtcgaggcc
gcgaacaactgtgcgctcgccacgcaatcgcatgcgctcaacattatggcgagcccgtgg
agcgcgccatggtggatgaaaacgaatctcagcgtgctcggcaaacggcgctacacgcgg
atcaccggccatctgcggcgcggcatgtatgccgcctatgcgcgctatatcaccggtttt
gcacgattgtatgcgcaacgcggactgccgctgttcgcgctcaccgtgacgaacgaaccc
gactacccgcagtcgcgatggccatcgatggcaatgaccccgcgcgagcaggcagagttc
gtcgcgcgccatctgcgccccatgctcgaccacgccggattggacggcacgcgcattctg
tgctgggaccacaactactccaccgaccattacccggacggcgccttcgtgcgagacatg
tacgccgattccgccgcactcgctgcctgcgccggctccgcatggcattattacggcgga
tccgcgcgcacgatgtctcgcattcacgacgcgtttccgaacaagggcatctgggtgacc
gaggcgagcggcggcgactggggaccacgcaatttcacacccgcgctgctctcgctaggc
acggcggtcattgacatgatgaacaactgggcgaggagcgccgtgttgtggaacatcgcg
ctcgacgagcacggcggtcccgactactactacctgcgcaacgatcgccggcattccgag
aaccgcggtctgatcaccgtgcgtgacgacggttcgatacgccgcaatgcagactactac
gcgctcggccacttctccaaatacgtgccgattggctcacattgcgtggaatgcgcgctc
gaccatgcgcaaggagtgcgtgccgccgccttcctcactccgaccggcacgctggttgcg
gttctcgccaacgagcgtgcggaatccatatgggtgcaatgcgaagtggatgacagcggg
atcggggtgcgcctgccctcccgatcgctgaccaccgtgctccgccggtga

DBGET integrated database retrieval system