KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07255Help
Entry
BANAN_07255       CDS       T02047                                 

Definition
PfkB family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BANAN_07255
Enzymes [BR:bni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BANAN_07255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1758581..1759549)
Genome map
AA seq 322 aa AA seqDB search
MNQILDKLEQIHGSVSVVGSMNADYTVTTERLPGPGETVTGGPLQVLPGGKSGNQAAAAA
KLGATVRMFGAVGSDSNADFLLAQLASAGVNTDGIRKVLGPSGTTVITVDSHGENTIVYS
PGSNANVTVEYIDAQRELLTASSVLGLCLESPLETVTACAAMCHEAGMKVLLNDSPFIAT
LPSELIAHADILLVNEHELVQLLHINEPEDDDWDSFDWAQAQRRLSKFGFDQAIVTLGGD
GSVVFDSTVEPSIIRIAPVRVDAVDTTGCGDSFMGTVLASLASGLSLEESAQLASYVSAY
AATGYGAQASYGTAAQIRERFR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagattctcgataaactggagcagattcacggctccgtttccgtggtcggctca
atgaacgcagattacacggtgactaccgagcgactccccgggccgggggagaccgtgact
ggtggcccgctgcaggtgctgcctggcggcaaatccggcaatcaggccgccgctgccgcc
aagctcggcgcaaccgtgcgcatgttcggtgcagtgggctccgactcgaatgcggatttc
ctgctggcccagctcgcatctgccggagtgaacaccgatggcattcgtaaggtgctcggc
cctagcggcacgacggtgatcactgtggattcccacggcgagaacaccattgtgtattcg
ccgggatccaacgcgaatgtgacggtggaatacatcgatgcgcagcgggagttgctcacc
gcatcctccgtgctgggactgtgtttggaaagcccgctcgagacggtgaccgcatgcgcg
gccatgtgccatgaggcgggtatgaaggtgctgctcaacgattcgccgttcattgcgaca
ctgccgtccgaactcattgcgcatgccgacattctgctggtcaatgagcatgagcttgtg
cagctgctgcacattaatgagccggaagacgacgactgggattcgttcgattgggcacaa
gctcagcgccggctgagtaagttcggtttcgatcaggcgattgtgacgcttggcggtgac
ggttcggtggtgttcgactccacggtggaaccgtcgattattcgcattgcaccggtgcgt
gtggatgcggtggataccacgggctgcggcgattcgttcatgggcaccgtgctggcttcg
ttggccagcggactgagcttggaggagtccgcgcaactggcttcgtacgtgtcggcatat
gcggccaccggctatggtgcgcaggcctcctatggcaccgccgcgcagattcgtgagcgc
ttccgttaa

DBGET integrated database retrieval system