KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07390Help
Entry
BANAN_07390       CDS       T02047                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bni00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BANAN_07390
  Lipid metabolism
   00561 Glycerolipid metabolism
    BANAN_07390
   00600 Sphingolipid metabolism
    BANAN_07390
Enzymes [BR:bni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BANAN_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1801869..1804250)
Genome map
AA seq 793 aa AA seqDB search
MLEHSRPALLKELMAARNTVSPDSNGRIVWGNGTVTLVFAAGDEKPVTLIGMSGRGMEPV
DENIAGEPDAQPIVELRSSLDGGGDNRLKLAVSAAGLKLRFVRAYELNRLDDAQHPVTLL
AIVQRDPNGDGPLVTSVFESMAHTSAVRTYTRLCSEEPYPVEAVSSMNATLPMEATKLED
SQVQIYWGESSWDCENAWQSAPLRSTTLRDRNQVINQGMSSARFARRSTSTWSTGEFEPM
GIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRVSAYGPEYDDHQWFVMLRDNQ
PFVTVPVSFVICAGDWQHAVAEMTVQRRALYRVKAMEMGRLEQAEQAKGLVVYNDYMNTL
WGDPRIEKELPLVEGASKVGADVFCIDAGWYDSEDGGWWDMVGEWKPSTNRFGNLRLAGL
IHDIQSHGMKAGLWLEPEVIGVRSPLAKTLPDSAFFCRHGSRIADQGRYHLDFRSPVARA
HATVTVDRLIDEFNVKFFKFDYNTTPGAGTDVDTDSVGEGLLDHCRAVQQWIEQIRAKHP
DVMIENCGSGAMRADYAMLSRLDIQSTSDQSDPLVYAAIAAGAGMTVLPEQQGNWGYAQQ
EMDDETAVFTLAAGILGRLYLSGFIDRMDEARLGLVRDAIALHRTILGGQSHLVPWWPCG
LPDFNSPWLAYGLRHAPTVTGLAHDEDWKGPERIDEAQYLTIWRRGGVGSLYLELGKGAH
IEQVFPDPSKPEHAPNAKPWTVEWVDPETVRIQVATDKGPSARIFAITYPQSSANGRADG
RVAGDAGHDIKGR
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacatagccgccccgcattgttgaaggagttgatggcggccaggaacacggtg
tcgccggattcaaatgggcgaatcgtatggggcaatggaacggtgacgctcgtattcgcc
gcgggcgacgagaagccggtgacgttgatcggcatgagcggccgcggcatggagccggtg
gatgagaacatcgctggcgaaccagatgcgcagccgattgtggagttgcgcagttcgctg
gacggcggcggagacaacaggctgaaactcgctgtttcggccgccggtctcaaactgagg
ttcgttcgggcatacgagctcaacagattggacgatgcgcagcatccggtcacgctgctc
gcgattgtgcaacgtgacccgaacggcgacggcccgctggtgacgagcgtgttcgagtcg
atggcccataccagtgcggtgcgaacctacacgcggctgtgcagcgaggagccatacccg
gtggaggcggtgtcgtcgatgaacgcgacactgcccatggaagcgaccaaacttgaggat
tcgcaggtgcagatctactggggcgaaagctcgtgggactgcgagaacgcctggcagagt
gcgccactgcgttccaccacgctgcgcgaccgtaaccaggtgatcaatcagggcatgtct
tccgccagattcgcccgccgttccacgtcgacatggtccaccggcgagttcgagccgatg
ggcattgtcgaaggaggcggccggccaggcgagctcggccatttctcgttcgcatggcag
attgagcacaacggtgcctgggaatgggagatcggcgaggacgacccgggactgcgtgtg
agtgcatacgggccggaatacgacgaccaccagtggttcgtcatgctgcgcgacaaccag
cccttcgtcacggtgccggtctcgttcgtgatctgcgcgggcgactggcagcacgccgtg
gccgagatgaccgtgcaacgacgtgcgctctaccgcgtgaaagccatggaaatgggtcgc
ttggaacaggcggagcaggcgaaggggctcgttgtttacaacgactacatgaacacgttg
tggggcgacccgcgcatcgaaaaggagctgccgctcgtggagggcgcctccaaggtgggc
gccgacgtgttctgcattgacgccggctggtacgacagcgaagatggcggctggtgggac
atggtgggtgaatggaagccctccaccaaccgcttcggcaaccttcgcttggccgggctc
atccacgacatccagtcgcatggcatgaaggccggcctgtggttggagccggaggtgatc
ggcgtgcgctcgccgttggcgaagacgctgccggattcggcgttcttctgcaggcacggc
agccgcatagcagatcagggccgctaccacctcgacttccgctcgccggtggcccgtgcc
catgccacggtcacagtggatcgcctgatcgatgagttcaacgtgaagttcttcaagttc
gactacaacacgacgccgggtgccggcaccgatgtcgacacggattcggtgggcgagggt
ctgctcgatcattgccgtgcggtgcagcagtggatcgagcagatccgcgccaagcacccc
gacgtgatgatcgagaactgcggttccggcgccatgcgcgccgactatgcgatgctgagc
cgactcgacatacagtccacctccgaccagtccgatccgctcgtctacgccgcaatcgcc
gctggcgccggcatgaccgtgttgccggagcaacagggcaactggggctacgcgcagcag
gagatggacgacgaaaccgccgtgttcacgctggccgcgggcattcttggccgcctgtac
ctgtcggggttcatcgaccgcatggacgaggcgcggttggggttggtgcgcgatgcgatc
gcattgcaccgcacgatcctgggcggccaatcgcatctggtgccgtggtggccttgtggg
ttgccggacttcaacagcccctggctcgcatacggcctgcgccatgcgccgacggtgacc
ggattggcccatgacgaggactggaagggccccgagcgcatcgatgaggcgcaatacctg
accatctggcgtcgcggcggcgtgggctcgctctatttggagctcggcaagggcgcgcat
atcgagcaggtgttccctgacccgtcaaagccggagcatgcgcccaatgccaagccgtgg
acggtcgaatgggtggatcccgagacggtgcgcatccaggtcgccaccgacaaggggccc
tccgcgcgaatcttcgccatcacctatccgcaatcatccgccaacggcagggcggacggc
agggtcgccggcgacgccgggcacgacatcaaagggcggtaa

DBGET integrated database retrieval system