KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07390Help
Entry
BANAN_07390       CDS       T02047                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bni00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bni00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bni00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1801869..1804250)
Genome map
AA seq 793 aa AA seqDB search
MLEHSRPALLKELMAARNTVSPDSNGRIVWGNGTVTLVFAAGDEKPVTLIGMSGRGMEPV
DENIAGEPDAQPIVELRSSLDGGGDNRLKLAVSAAGLKLRFVRAYELNRLDDAQHPVTLL
AIVQRDPNGDGPLVTSVFESMAHTSAVRTYTRLCSEEPYPVEAVSSMNATLPMEATKLED
SQVQIYWGESSWDCENAWQSAPLRSTTLRDRNQVINQGMSSARFARRSTSTWSTGEFEPM
GIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRVSAYGPEYDDHQWFVMLRDNQ
PFVTVPVSFVICAGDWQHAVAEMTVQRRALYRVKAMEMGRLEQAEQAKGLVVYNDYMNTL
WGDPRIEKELPLVEGASKVGADVFCIDAGWYDSEDGGWWDMVGEWKPSTNRFGNLRLAGL
IHDIQSHGMKAGLWLEPEVIGVRSPLAKTLPDSAFFCRHGSRIADQGRYHLDFRSPVARA
HATVTVDRLIDEFNVKFFKFDYNTTPGAGTDVDTDSVGEGLLDHCRAVQQWIEQIRAKHP
DVMIENCGSGAMRADYAMLSRLDIQSTSDQSDPLVYAAIAAGAGMTVLPEQQGNWGYAQQ
EMDDETAVFTLAAGILGRLYLSGFIDRMDEARLGLVRDAIALHRTILGGQSHLVPWWPCG
LPDFNSPWLAYGLRHAPTVTGLAHDEDWKGPERIDEAQYLTIWRRGGVGSLYLELGKGAH
IEQVFPDPSKPEHAPNAKPWTVEWVDPETVRIQVATDKGPSARIFAITYPQSSANGRADG
RVAGDAGHDIKGR
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacatagccgccccgcattgttgaaggagttgatggcggccaggaacacggtg
tcgccggattcaaatgggcgaatcgtatggggcaatggaacggtgacgctcgtattcgcc
gcgggcgacgagaagccggtgacgttgatcggcatgagcggccgcggcatggagccggtg
gatgagaacatcgctggcgaaccagatgcgcagccgattgtggagttgcgcagttcgctg
gacggcggcggagacaacaggctgaaactcgctgtttcggccgccggtctcaaactgagg
ttcgttcgggcatacgagctcaacagattggacgatgcgcagcatccggtcacgctgctc
gcgattgtgcaacgtgacccgaacggcgacggcccgctggtgacgagcgtgttcgagtcg
atggcccataccagtgcggtgcgaacctacacgcggctgtgcagcgaggagccatacccg
gtggaggcggtgtcgtcgatgaacgcgacactgcccatggaagcgaccaaacttgaggat
tcgcaggtgcagatctactggggcgaaagctcgtgggactgcgagaacgcctggcagagt
gcgccactgcgttccaccacgctgcgcgaccgtaaccaggtgatcaatcagggcatgtct
tccgccagattcgcccgccgttccacgtcgacatggtccaccggcgagttcgagccgatg
ggcattgtcgaaggaggcggccggccaggcgagctcggccatttctcgttcgcatggcag
attgagcacaacggtgcctgggaatgggagatcggcgaggacgacccgggactgcgtgtg
agtgcatacgggccggaatacgacgaccaccagtggttcgtcatgctgcgcgacaaccag
cccttcgtcacggtgccggtctcgttcgtgatctgcgcgggcgactggcagcacgccgtg
gccgagatgaccgtgcaacgacgtgcgctctaccgcgtgaaagccatggaaatgggtcgc
ttggaacaggcggagcaggcgaaggggctcgttgtttacaacgactacatgaacacgttg
tggggcgacccgcgcatcgaaaaggagctgccgctcgtggagggcgcctccaaggtgggc
gccgacgtgttctgcattgacgccggctggtacgacagcgaagatggcggctggtgggac
atggtgggtgaatggaagccctccaccaaccgcttcggcaaccttcgcttggccgggctc
atccacgacatccagtcgcatggcatgaaggccggcctgtggttggagccggaggtgatc
ggcgtgcgctcgccgttggcgaagacgctgccggattcggcgttcttctgcaggcacggc
agccgcatagcagatcagggccgctaccacctcgacttccgctcgccggtggcccgtgcc
catgccacggtcacagtggatcgcctgatcgatgagttcaacgtgaagttcttcaagttc
gactacaacacgacgccgggtgccggcaccgatgtcgacacggattcggtgggcgagggt
ctgctcgatcattgccgtgcggtgcagcagtggatcgagcagatccgcgccaagcacccc
gacgtgatgatcgagaactgcggttccggcgccatgcgcgccgactatgcgatgctgagc
cgactcgacatacagtccacctccgaccagtccgatccgctcgtctacgccgcaatcgcc
gctggcgccggcatgaccgtgttgccggagcaacagggcaactggggctacgcgcagcag
gagatggacgacgaaaccgccgtgttcacgctggccgcgggcattcttggccgcctgtac
ctgtcggggttcatcgaccgcatggacgaggcgcggttggggttggtgcgcgatgcgatc
gcattgcaccgcacgatcctgggcggccaatcgcatctggtgccgtggtggccttgtggg
ttgccggacttcaacagcccctggctcgcatacggcctgcgccatgcgccgacggtgacc
ggattggcccatgacgaggactggaagggccccgagcgcatcgatgaggcgcaatacctg
accatctggcgtcgcggcggcgtgggctcgctctatttggagctcggcaagggcgcgcat
atcgagcaggtgttccctgacccgtcaaagccggagcatgcgcccaatgccaagccgtgg
acggtcgaatgggtggatcccgagacggtgcgcatccaggtcgccaccgacaaggggccc
tccgcgcgaatcttcgccatcacctatccgcaatcatccgccaacggcagggcggacggc
agggtcgccggcgacgccgggcacgacatcaaagggcggtaa

DBGET integrated database retrieval system