KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07770Help
Entry
BANAN_07770       CDS       T02047                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bni00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913543..1914499
Genome map
AA seq 318 aa AA seqDB search
MSAPNGARFQTPMLRADYASVHVDCPAKTNLTLHVGERREEWDGRHTLETIYCGVGIYDT
VTVTAKEPGTGFSLDLAGTHLGDLAASTSDMRRNHAVLAMFAMAQASGHEPDVSISIEKR
IPVAAGLGGGSADAAGTLLALNALWNLNWPVARLREIAATLGADMPFCVTGGLALGTGFG
ERIEDLTASDPRIEHAVGDLFADAPSGDGAHMLVGAYLSQLSTPEVYSTFDVLGAGEGDL
NELQHAAVSLHPRSGVAIREAQQAGATSAFVSGSGPTVIAVVPNDRVREATRAAWQASGA
VDRIIEAQVPAVPLMRAE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccaacggcgcccgattccagacccccatgctccgcgcagactacgccagc
gtgcatgtggactgccctgccaagacgaatctcacattgcatgtgggggaacgccgtgag
gaatgggacggcagacataccttggagaccatctactgcggcgtgggcatatacgacacg
gtgacggtgaccgccaaggaaccgggaaccggcttctccctcgatctcgctggcactcat
ttgggagacctggccgcgtcaacgagcgacatgcgcaggaaccatgccgtgctcgccatg
ttcgcgatggcgcaggccagcgggcacgaacctgacgtctccattagcatagagaagcgc
attcccgtcgcagccggcctgggaggcggctcggcggatgcggcaggcacactgctcgcg
ctcaatgcgttgtggaatctcaattggccagtggcacgactccgcgagatagcggccacc
ttgggcgccgacatgccgttctgcgttaccggcggcctggctttgggcaccggcttcggc
gagcgtatagaggatctgaccgcatccgacccgcgtatcgaacatgcggtgggcgatctg
ttcgcagatgccccctccggcgatggcgcgcacatgctcgtcggcgcatacctgtcacag
ctgagcacgccagaagtctactccaccttcgacgtgctcggcgcaggagaaggcgacctc
aacgagttgcagcacgccgccgtctcgctgcatccgcgcagcggcgtggccatccgcgaa
gctcagcaggcgggcgcgacgagtgccttcgtctccggatcgggccctaccgtgatcgcc
gtggtgcctaacgaccgggtgcgcgaggcgacgcgcgcggcatggcaggcttccggggcc
gtcgaccgcatcatcgaagcacaggtgccggccgtaccgctcatgcgagccgagtag

DBGET integrated database retrieval system