KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00010Help
Entry
BALAC2494_00010   CDS       T01842                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BALAC2494_00010
Enzymes [BR:bnm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BALAC2494_00010
Exosome [BR:bnm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BALAC2494_00010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136322..1138673
Genome map
AA seq 783 aa AA seqDB search
MPYRLDLQGFWAKKTLFYAEWLPNPVLHAYPLCMSNNHFNKDAIVAVDHAQLGTVSEGRF
YNPHEILGAHLGSGEYSDTATVRVLRPDAKEVVIVTPDSETKAEPELNGVYVAVVPAVKT
DRGYSVPDYRLRITKEDGSTVVENDPYRYLPTVGEMDLYLFGEGRHERLWEAMGANVKRY
EDSMGGNDGTHGEPVVGTAFTVWAPNAHSVRVVGDFNGWNGICHSMRELGSSGVWEIFIP
GVTAGEKYKYQILNVFNTWEMKADPMERSHEVPPKTASIVVESEYHWNDSDWMAKRAKTD
PHQGPVAIYEVNANSWRDDVHSYRELADKLVPYVAKLGFTHVEFMPLEEYPYLGSWGYQV
TGYYGVDSRLGSPDDFKYLVDKLHEAGIGVIMDWVPAHFPKDAFALGRFDGTPLYEDPDP
TRGEHPDWGTYIFNFGRREVRNFLVADACFWLDEYHMDGLRVDAVSSMLYLDYSRQPGQW
HPNKFGGRENLEAIDFIKEANATAYKNNPGIMMIAEESTAYPGVTAPTDQGGLGYGLKWN
MGWMHDTLEYLHEQPINRKWHHNEITFSMVYAYSEHYVLPISHDEVVYGKGSLFGKMPGD
DWQRYAGVRSLFAYQWAHPGKNLTFMGNELAQYGEWDYNSQLDWDCLNWPDHRGVQQLVA
DLNALYKKSPALWSQDFTPDGFQWLTSDDSDHNTLSFVRIGKNGEQMVVVVNFSGTAWQD
YQVALPQGGRWREVLTTDDRKYGGSDIHNTNIEANAGPYHSRDYSTKITVPALGVVFLEP
DNN
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgccctatcgcttggacttgcaagggttttgggcaaaaaagacgcttttttacgcagaa
tggctcccgaaccccgtgttgcatgcttatcctctatgtatgagtaacaatcatttcaat
aaagatgccatcgttgcagtggatcatgcccaactcggcaccgtgagcgagggtcgtttc
tacaaccctcacgagattctcggcgcccacctcggtagcggtgaatacagcgacaccgcc
accgtccgcgtacttcgccctgacgccaaggaagtcgtcatcgtcacccccgacagcgag
accaaggccgaaccggaactcaacggcgtctatgtcgccgtggttcccgccgtgaaaacc
gacagggggtattcggttcccgactaccgcctgcgcatcaccaaggaggacggctccacg
gtggtggagaacgacccgtatcgatacctgccgaccgtgggtgagatggatctctacctg
ttcggcgaaggacgccatgaacgcctatgggaggccatgggcgccaacgtcaagcgatat
gaggactccatgggtggcaatgatggcacccatggcgaacctgtggtcggcactgcattc
accgtctgggcgccgaatgcacattcggtgcgagtggtgggcgatttcaacggatggaac
ggcatctgccattcgatgcgcgaactcggctcctccggcgtctgggaaatctttatcccg
ggtgtgacggccggcgagaaatacaaatatcagattctcaacgtattcaacacttgggag
atgaaggccgacccaatggaacgctcgcacgaggtgccaccgaagacggcctcgattgtg
gtggagtccgaataccattggaacgattccgactggatggccaagcgcgcgaaaaccgac
ccgcaccagggtcccgtggcgatctacgaggtaaatgcgaacagttggcgtgacgacgta
cacagctaccgcgagcttgccgacaagctcgtgccgtacgtcgcgaagctgggcttcacc
cacgtggaattcatgccgttggaggaatacccgtacctcggcagctggggctatcaggtg
accggctattatggcgtggactcccgcctgggctcccccgacgacttcaagtatctcgtc
gacaagcttcacgaggcgggtatcggtgtaatcatggattgggtcccggcgcacttcccg
aaggacgccttcgcattgggccgtttcgatggaacgccattgtatgaggacccggatccg
acccgcggcgagcatccggattgggggacgtacatcttcaacttcggccgccgcgaggtg
cgcaacttcctggtggccgacgcctgcttctggcttgatgagtaccatatggacggcctg
cgcgtcgacgcggtctcctcgatgctctacctcgactacagccgtcaacccggtcaatgg
catccgaacaagttcggaggacgcgagaacctcgaggccatcgacttcatcaaggaggcc
aacgccacggcctacaagaacaatccgggcatcatgatgatcgccgaggaatccactgcc
tacccgggcgtcaccgccccgaccgaccagggcggtctgggttatggactcaaatggaac
atgggctggatgcacgatacgcttgaatacctgcacgagcagccgatcaaccgcaagtgg
caccacaacgagatcacgttctccatggtctacgcctattcggagcattatgtgctgccg
atcagccatgacgaggtggtgtacggcaaaggatcgctgttcggcaagatgccgggcgac
gattggcagcgctacgccggcgtgcgttccctgttcgcctatcaatgggcacatccgggc
aagaacctcaccttcatgggcaatgaactcgcacagtacggtgagtgggactacaacagc
cagcttgactgggactgcctgaactggcctgatcaccgtggcgtgcagcaactggtggcc
gacctcaacgctctgtacaagaagtctccagccctgtggagccaggacttcacccccgac
ggtttccagtggctcaccagtgacgattcggaccacaatacgttgagcttcgtgcgaatc
ggcaaaaacggcgagcagatggtcgtcgtggtcaacttctccggaacggcatggcaggac
taccaggtggcgctcccacaaggcggccgttggcgggaggtactcaccactgacgacagg
aagtacggcgggtccgacatccacaacaccaatatcgaagccaacgccggcccctaccat
tcgcgcgattattctacgaagataaccgtgccggccctcggtgtcgtattcttggaaccg
gataacaactga

DBGET integrated database retrieval system