KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00225Help
Entry
BALAC2494_00225   CDS       T01842                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BALAC2494_00225
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BALAC2494_00225
Enzymes [BR:bnm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BALAC2494_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1173844..1175349
Genome map
AA seq 501 aa AA seqDB search
MEEVLGFSSVPTRLPMYFQILPPDRRDQGFVKVSFAVALLRWHPAPPAAICARELYNDSS
HRRNRGPMIQHNDKPQPNRNRRMVRIVTTVIVTLAIVAIAIGAFAPVRHATDSDTTNGKA
APTSVPSRTSSPAPSTTISMPQTASPSPTPKTDGTSDRAKRIVEAMSLDERAGQLVMAAL
QYGNDPATLQAMIQEQHVGNVILMGNWVSGVENVARATQALQRLNASTGLPGLLIATDQE
GGTVQHLSGPGFDAMPSATAQGQMPLDRLRAAARDWALPLKRSGLAMNLAPSVDTVTIER
AVNEPIGALYRDFGLDAQRNGEHAAAFIEGMRAGGVGSAIKHYPGLGSVRGNTDFTANGI
VDDTTTENGTEVNAFTSAIRQGKPAMVMVSLATYKLIDPDNPAAFSPAIVTDMLRRGTPF
DGVVISDSLSAGAVSSIAPQDLGVRFIDAGGDICCMNAASYTQPILDGIRSRAAADKGFA
AKVTASAERVVRLKIELGLVQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttggaggaagtgcttggtttctcttctgtacctacacgtttgcctatgtatttccagatc
cttccccctgacaggcgcgatcaaggcttcgtcaaggtgtccttcgcggtagcgctcctc
aggtggcatccggccccaccggcggcaatctgtgcccgcgaactgtacaatgacagcagc
catcgcagaaaccgaggacccatgatccagcacaacgacaagccacagccgaaccggaac
aggcgcatggtccggattgtcacgaccgtcatcgtgacattggcaatcgtcgccattgcg
attggggcattcgcaccggttcgccatgctaccgattccgacacgacgaatggcaaagcc
gccccgacatcggttcccagccgcacatcatcgccagcccccagcacgaccatttccatg
ccgcagacagcgtcgccttcgcccacccccaagacggatggcacctcggatcgggccaaa
cgcattgtagaggcgatgagcctcgacgaacgcgccgggcaattggtgatggccgcattg
caatacggcaatgaccctgccaccttgcaagcgatgattcaggagcagcatgtggggaac
gtgatcctgatgggcaactgggtgagcggcgtcgagaacgtggcgcgtgccacacaggca
ctgcagaggttgaacgcctccaccggattgccaggattgctcatcgccaccgatcaggag
ggcggcacggtccagcatctttcgggaccgggattcgatgccatgcccagcgccacggct
cagggtcagatgccactcgaccggctgcgcgcagccgcgcgggattgggccctccccctc
aaacggtccggtctcgccatgaatctggctccttcggtggacacggtgacgatcgaacgt
gccgtcaatgaaccgatcggcgcgctctaccgtgatttcggactcgatgcccagcgcaat
ggcgagcatgctgcagctttcatcgaaggcatgcgcgccggcggtgtgggcagtgccatc
aagcattacccgggattgggatcggtgaggggcaacaccgatttcacggcaaacggcatt
gtcgacgacacgacaaccgagaacggcacggaggtgaatgcattcacctctgcgatccgg
cagggcaaacccgccatggtgatggtgtcgctggccacctacaaactcatcgaccccgac
aatcctgcagccttctcccccgccatcgtcaccgacatgctgcgcagaggtaccccgttc
gacggcgtggtgatctcggattccctctcggccggtgccgtgagctcgattgctccacag
gatctgggcgtgcggttcattgatgcgggaggggacatctgctgcatgaacgccgcaagc
tatacgcagccaattctggacggcatacgcagccgcgctgccgcggacaagggttttgcc
gccaaggtcactgcgagtgccgaacgcgtggtgagactgaaaatagagctcggcttggtg
cagtga

DBGET integrated database retrieval system