KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00280Help
Entry
BALAC2494_00280   CDS       T01842                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALAC2494_00280
   01230 Biosynthesis of amino acids
    BALAC2494_00280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALAC2494_00280
   00051 Fructose and mannose metabolism
    BALAC2494_00280
   00562 Inositol phosphate metabolism
    BALAC2494_00280
Enzymes [BR:bnm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BALAC2494_00280
Exosome [BR:bnm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BALAC2494_00280
  Exosomal proteins of bladder cancer cells
   BALAC2494_00280
  Exosomal proteins of melanoma cells
   BALAC2494_00280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(974079..974951)
Genome map
AA seq 290 aa AA seqDB search
MAPGNRYWAPRSHMEDRQGNMASTRRIPMVAGNWKMNFDHLEATEFVRAFSKNLKRCHFD
FNRCEVALFPSFTSIRSVQVMVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSY
VIVGHSERRKYHPEDDANIVDQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDV
TRDLSDGEASKLIIAYEPVWAIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLY
GGSVSSKNCVELIEEPDVDGFLIGGAALDVDELTTICRKTIATTSSHDNS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcccggcaataggtactgggcgccacgttctcatatggaggacaggcaaggcaat
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcgaccgagttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaatcgttgcgaagtggcgctcttcccgtcattcacctcgattcgtagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccaatcctatgcgtcggcgagagt
ctggaggagaggcgaaagggcattgaacttgagtttgccgtcggacaggtgcatgacgtg
acacgcgacctttccgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgctacaccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcattcggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccggacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatagttga

DBGET integrated database retrieval system