KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00305Help
Entry
BALAC2494_00305   CDS       T01842                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00020  Citrate cycle (TCA cycle)
bnm00640  Propanoate metabolism
bnm00660  C5-Branched dibasic acid metabolism
bnm01100  Metabolic pathways
bnm01110  Biosynthesis of secondary metabolites
bnm01120  Microbial metabolism in diverse environments
bnm01130  Biosynthesis of antibiotics
bnm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BALAC2494_00305
   00640 Propanoate metabolism
    BALAC2494_00305
   00660 C5-Branched dibasic acid metabolism
    BALAC2494_00305
Enzymes [BR:bnm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BALAC2494_00305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 Glu_synthase GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEK30272
Position
complement(945644..946837)
Genome map
AA seq 397 aa AA seqDB search
MDLYEYQARQLLEEQDIDVPKAVFAQNSHEVAEAADIIGYPVVIKAQVKIGHRGQAGGVR
IAHDRDEAILISEDILPMTIHGHKVSGILVTEAKNILHEYYVSISVDRSSRDFDVLATAN
GGTEVEEVARKHPESVKRLHISALEDFDLEAATKMAESIGFYHADSAQAAQILLNMWRCF
KQNDATLVEINPLAKVGDPDDESSKSLCALDAKISLDDNAAFRHDGWKRFADPIVPDPFE
QRAREHNLHYVHLTGEVGVIGNGAGLVMSSLDAVAFAGEEQGTGVKAANFLDIGGGASSQ
VMCESLEIILSDPQVESVFINVYGGITSCEQVALGILEAADQLGASKPMVVRFEGNKADE
GLRILAEADNPNIHVCETMGQAAAEAARLAAHGKEER
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaatatcaggcacgtcagctgctcgaagagcaggacatcgatgtgccg
aaggcggtgttcgcacagaattcacatgaggtggccgaagccgccgacatcatcggatat
ccggtcgtgatcaaggcacaggtgaagatcggacatcgcgggcaggcaggcggtgtgcgc
attgcacatgaccgtgacgaggcgatactcatctccgaggatatccttccgatgaccatc
catggtcataaggtgagtggcatcctggtgaccgaagccaagaacatcctccacgaatac
tatgtgtccatctcggttgatcgctcctcgcgcgacttcgacgtcctggccacggccaac
ggcggcactgaagtcgaagaagtcgcacgcaagcatccggaatctgtgaaacggctgcat
ataagcgctcttgaggacttcgacctcgaagcagcaacaaaaatggccgagagcatcggc
ttctaccacgcggattcagctcaggcggcgcagatcctgctcaacatgtggcgctgcttc
aagcagaacgatgccaccctcgtggagatcaacccattggccaaagtcggcgacccggac
gacgaatcttcgaagtcgttgtgcgcattggatgcgaaaatctcactcgacgacaacgca
gccttccgtcacgatggatggaagcgctttgccgacccgatcgtcccggatccgtttgaa
cagcgtgcccgtgaacacaatctgcattacgtgcatctcaccggcgaggtcggtgtcatc
ggcaacggggcgggcttggtgatgagctccctcgacgccgtcgcattcgcgggcgaggaa
cagggcaccggtgtgaaggccgcgaacttcctcgacatcggcgggggagcctcctcgcag
gtcatgtgcgaaagccttgagatcattctctccgacccccaggtggaatccgtgttcatc
aatgtgtatggaggcatcacctcctgtgaacaggtagctctcggcattctcgaggcggcg
gatcagctcggcgcatccaagccgatggtcgttcggttcgaggggaacaaggccgatgag
gggcttcggattctcgccgaggccgataacccgaacatccatgtatgcgagaccatgggg
caggcggccgccgaggcggctcgtctcgccgcccatggcaaggaggagcgttaa

DBGET integrated database retrieval system