KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00322Help
Entry
BALAC2494_00322   CDS       T01842                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BALAC2494_00322
   00052 Galactose metabolism
    BALAC2494_00322
   00500 Starch and sucrose metabolism
    BALAC2494_00322
   00520 Amino sugar and nucleotide sugar metabolism
    BALAC2494_00322
Enzymes [BR:bnm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BALAC2494_00322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(935444..936871)
Genome map
AA seq 475 aa AA seqDB search
MTDAFERTAEKMKAHGLSETAIAQFEHLYDVWQHEDGTTWIREEDIEPVQDIPNFAQIYE
TINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKAKQMRFIDIILGQVETAR
NRLGVELPLTFMNSFRTSADTMKVLNRDKRFHQDDIPMEIIQHVEPKIDLSTGEPVSFPS
NPDLEWCPPGHGDLYSTLWESGLLDILESHGFKYLFISNSDNLGARPSRTLAQHFENTDA
PFMIEVSKRTEADRKGGHIVRDKVTGRLMLREMTQVAPEDAAEAKNIDKHPYFNTNNIWV
RIDSLREKLAQSNGVLPLPVIRNYKTVDPTDASTTEVIQLETAMGAAVSLFNGAICVEVD
RMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPNVQLDTRFYKNIHDFDDRFPYGV
PSLAAAASVTVEGDWTFGRDVNFYGEATLHDEGRPSYVPNGEFVGPQGIEPDEWL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcgagcgaaccgccgagaagatgaaggcccacggcctgagcgagacg
gccatagcccaattcgagcatctctatgatgtgtggcagcacgaggacggcaccacttgg
attcgcgaggaggacatcgagccggtccaggacattcccaatttcgcgcagatctatgag
acgatcaaccacgacaaggcggtcgacgcattcgccaagacggcgttcctcaagctcaac
ggcggtctgggaacctcgatggggctcgactgcgcaaaatcattgttgccggttcgcagg
cacaaagccaagcaaatgcgcttcatcgacatcattctcggacaggtggaaaccgcacgc
aaccgactgggcgtggagctcccgctgacgttcatgaactcgttccgcacatcggccgac
accatgaaggtgctcaaccgagacaagcggttccatcaggatgatattccgatggagatc
atccagcacgtggagcccaagatcgatctttcgacgggggagccggtgtcattcccctcc
aatcccgatctcgaatggtgcccacccgggcacggcgacctgtattcgaccctctgggaa
tcgggtctgctcgacattctcgaaagccacggattcaagtacctgttcatctcgaactca
gacaatctgggggcacgtccgtcacgcactctggcccagcacttcgaaaacaccgacgct
ccgttcatgatcgaagtgtcgaaacgcaccgaagcggatcgcaagggtggtcacatcgtt
cgcgacaaggtcaccggtagactcatgttgcgcgagatgacgcaggtggcccctgaagac
gcggcggaagccaagaacatcgacaagcatccgtatttcaatacgaacaacatctgggtg
cgcatcgactccctacgcgagaagctggcacagagcaacggcgtgctcccgttgcctgtc
attcgcaattacaagaccgtcgacccaacggatgcctccaccaccgaggtgattcagctc
gagaccgcgatgggcgctgcagtgagtctgttcaatggggcgatctgcgtcgaggtggac
cgcatgcgcttcctgccggtgaaaaccaccgacgacctgttcatcatgcgctccgaccgc
ttccatctgaccgatcagtacgagatggaggacggcaactacatcttcccgaacgtccag
cttgacacgcgcttctacaagaacatccatgatttcgacgaccgcttcccctacggcgtg
ccatcgcttgcagcggctgcctcggtcacggtggagggggattggaccttcggccgtgat
gtgaacttctatggtgaggcgacattgcatgatgagggtaggccgagttatgtcccaaac
ggcgaattcgtaggaccgcagggtatagagcccgacgaatggctgtag

DBGET integrated database retrieval system