KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00322Help
Entry
BALAC2494_00322   CDS       T01842                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00040  Pentose and glucuronate interconversions
bnm00052  Galactose metabolism
bnm00500  Starch and sucrose metabolism
bnm00520  Amino sugar and nucleotide sugar metabolism
bnm01100  Metabolic pathways
bnm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BALAC2494_00322
   00052 Galactose metabolism
    BALAC2494_00322
   00500 Starch and sucrose metabolism
    BALAC2494_00322
   00520 Amino sugar and nucleotide sugar metabolism
    BALAC2494_00322
Enzymes [BR:bnm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BALAC2494_00322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: AEK30265
Position
complement(935444..936871)
Genome map
AA seq 475 aa AA seqDB search
MTDAFERTAEKMKAHGLSETAIAQFEHLYDVWQHEDGTTWIREEDIEPVQDIPNFAQIYE
TINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKAKQMRFIDIILGQVETAR
NRLGVELPLTFMNSFRTSADTMKVLNRDKRFHQDDIPMEIIQHVEPKIDLSTGEPVSFPS
NPDLEWCPPGHGDLYSTLWESGLLDILESHGFKYLFISNSDNLGARPSRTLAQHFENTDA
PFMIEVSKRTEADRKGGHIVRDKVTGRLMLREMTQVAPEDAAEAKNIDKHPYFNTNNIWV
RIDSLREKLAQSNGVLPLPVIRNYKTVDPTDASTTEVIQLETAMGAAVSLFNGAICVEVD
RMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPNVQLDTRFYKNIHDFDDRFPYGV
PSLAAAASVTVEGDWTFGRDVNFYGEATLHDEGRPSYVPNGEFVGPQGIEPDEWL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcgagcgaaccgccgagaagatgaaggcccacggcctgagcgagacg
gccatagcccaattcgagcatctctatgatgtgtggcagcacgaggacggcaccacttgg
attcgcgaggaggacatcgagccggtccaggacattcccaatttcgcgcagatctatgag
acgatcaaccacgacaaggcggtcgacgcattcgccaagacggcgttcctcaagctcaac
ggcggtctgggaacctcgatggggctcgactgcgcaaaatcattgttgccggttcgcagg
cacaaagccaagcaaatgcgcttcatcgacatcattctcggacaggtggaaaccgcacgc
aaccgactgggcgtggagctcccgctgacgttcatgaactcgttccgcacatcggccgac
accatgaaggtgctcaaccgagacaagcggttccatcaggatgatattccgatggagatc
atccagcacgtggagcccaagatcgatctttcgacgggggagccggtgtcattcccctcc
aatcccgatctcgaatggtgcccacccgggcacggcgacctgtattcgaccctctgggaa
tcgggtctgctcgacattctcgaaagccacggattcaagtacctgttcatctcgaactca
gacaatctgggggcacgtccgtcacgcactctggcccagcacttcgaaaacaccgacgct
ccgttcatgatcgaagtgtcgaaacgcaccgaagcggatcgcaagggtggtcacatcgtt
cgcgacaaggtcaccggtagactcatgttgcgcgagatgacgcaggtggcccctgaagac
gcggcggaagccaagaacatcgacaagcatccgtatttcaatacgaacaacatctgggtg
cgcatcgactccctacgcgagaagctggcacagagcaacggcgtgctcccgttgcctgtc
attcgcaattacaagaccgtcgacccaacggatgcctccaccaccgaggtgattcagctc
gagaccgcgatgggcgctgcagtgagtctgttcaatggggcgatctgcgtcgaggtggac
cgcatgcgcttcctgccggtgaaaaccaccgacgacctgttcatcatgcgctccgaccgc
ttccatctgaccgatcagtacgagatggaggacggcaactacatcttcccgaacgtccag
cttgacacgcgcttctacaagaacatccatgatttcgacgaccgcttcccctacggcgtg
ccatcgcttgcagcggctgcctcggtcacggtggagggggattggaccttcggccgtgat
gtgaacttctatggtgaggcgacattgcatgatgagggtaggccgagttatgtcccaaac
ggcgaattcgtaggaccgcagggtatagagcccgacgaatggctgtag

DBGET integrated database retrieval system