KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00341Help
Entry
BALAC2494_00341   CDS       T01842                                 

Definition
Tryptophan synthase (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BALAC2494_00341
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALAC2494_00341
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BALAC2494_00341
Enzymes [BR:bnm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BALAC2494_00341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919304..920251
Genome map
AA seq 315 aa AA seqDB search
MSRQPHSRRTVRPATTRERVSGIGADMTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDK
PAFIGYLPFGFPTMEQSLEAFATMVENGADIVEIGLPYSDPVMDGPVIQAASQIALNNGE
RIADVFKAVETVANAGGVPLIMSYWNLIYHYGVERFAADFANAGGAGLITPDLIPDEAGE
WIEASDRHGLDRIFLVSPDSTDERLRVVCENARGFVYAASRMGVTGERSSLGTSPEDLVA
RTRKAGAENVCVGIGVSTAAQGKAVGQYADGVIVGSALVHTLLTEDGDARELTSGLAALA
AKTAELAEGIHNARL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtgaacgagta
agtggaataggagcagatatgaccgaatacaacaccacgccaagcggtcagccgcttgga
atcagccatcgtcccagcccatgccgcgagctgttcacacggttcaaagcgcaggacaag
cctgcattcattgggtacctgccattcggattccccacgatggaacagtcactcgaggcc
ttcgccacgatggtcgagaacggtgctgacattgtcgagataggactgccgtattccgat
ccggtgatggatggcccggtgatccaggccgccagccagatcgccctgaacaatggcgag
cgcatagccgatgtgttcaaggccgtggagacggtggccaatgccggtggagtgccgctc
atcatgagctactggaacctcatctaccattatggggttgaacgcttcgccgctgatttc
gcgaatgcaggaggcgcaggccttatcactcccgatctcattcccgacgaggcaggggag
tggatcgaggcgtcggaccgccatgggctcgatcgcatcttccttgtttcccccgactcc
accgatgagcgtctgcgggtggtgtgtgaaaacgcccggggattcgtctatgcggcatcg
cgcatgggcgtgactggcgaacggtcgagtctagggacttccccggaggatcttgtggcc
cggacccgtaaggccggggccgagaatgtgtgtgtgggcatcggcgtctccaccgctgct
caaggcaaggccgtcgggcagtatgcagacggggtcatcgttggatccgccttggtccac
accctgctcaccgaggatggcgatgcgcgcgagctcacctcaggtctggctgcgttggcg
gccaagaccgcagaactcgccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system