KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00342Help
Entry
BALAC2494_00342   CDS       T01842                                 

Definition
Tryptophan synthase (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bnm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bnm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bnm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917137..919356
Genome map
AA seq 739 aa AA seqDB search
MRRAVCRRREGTDHDSDVDMRSSPAFRYSDYDGKGPLSHRIPRRSMSVLDELVAGALEDK
CDRERVTSLEELKARAASAPAPLDAKRWLRRHDGIPVIAEIKRASPSKGHLIDIEDPAAL
GRQYEQGGASAISVLTEGRRFLGSLDDVDAVRAAVHIPVLRKDFITTDYQIWEARAHGAD
IVLLIVAALDDTQLAHLLKLTHELGMTALVETHTREEIERAIAAGARVIGINARNLKDLR
VDVGKYTELASNLPEDVIKVAESGVFGAVEVEDYARAGADAVLVGEGVATADDPRLAVER
LVKAGERVKASETTPLSEHHGPYWGQFGGRYVPEALITALDELQRVYDDAKDDPEFHKEL
ATLNKRYVGRPSPLTEAPRFAERIKERTGLDARVFLKREDLNHTGAHKINNAIGQALLVK
RMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQALNVARMRMLGAEVVEV
TLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPEMVRDFQKIIGEEAKEQLAQW
YGIDHPDAICACVGGGSNAIGIMNAFLDDPRVNLYGFEAGGHGPDSGQHAIRFAPGTGEL
GMFQGAKSYLLGNSEGQTLDTYSISAGLDYASVGPEHAWLKEIGRVNYSWATDEEAMNAF
KDLCETEGIIPAIESSHAVAGAYKAARDLKEKGYEHPVMIVNISGRGDKDMNTAGKWFGY
LTDEQAAALEANGATGNNA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgagccgtatgtcgccggcgagaaggaacagaccacgattcagacgtcgacatg
cgttcgtcacctgcattccgttacagtgactatgacgggaagggcccgttgagccatcgc
atcccaaggaggagcatgtcggttttggatgaactggtagcgggggcactcgaagacaag
tgcgaccgtgaacgcgtaacgtcgttggaagagctcaaggcccgggctgcctcggctccg
gctcccctcgacgcgaaacgatggcttaggcgtcacgacggcattccggtgattgccgaa
ataaagcgtgcctcgccgtcgaaagggcatctcatcgatatagaagaccctgccgctttg
ggccgacaatacgaacaaggcggtgcgagcgcaatctcggtgctcactgaaggccgcagg
ttcctcgggtctcttgacgatgtcgatgccgtacgtgccgctgtgcacatcccggtgctt
cggaaggatttcatcaccacggattaccagatctgggaggcgcgtgcgcatggggcggac
atcgtgctgctcatcgtcgcggcgcttgacgacacccagctggcgcatctgctgaagctc
acgcatgaactcggtatgaccgccttggtcgaaacgcatacccgtgaggaaatcgagcgg
gccatcgcggccggcgcgcgtgtgatcggcatcaatgcgcgcaatctgaaggatttgcgc
gtcgatgtgggcaaatacaccgagttggcgagcaatctgcccgaagatgtgatcaaggtg
gccgagtccggtgtattcggtgccgttgaagttgaggattatgcccgcgccggagccgac
gctgttctggtgggagagggcgtggccaccgccgatgacccgcggctggccgtggaacga
ttagtgaaggcaggagaacgagtgaaagcttctgaaaccactccgttgagcgaacatcat
ggcccgtattgggggcagttcggcggtcgctatgtgccggaggcgcttatcaccgccctc
gatgaattgcagcgtgtgtacgacgacgcgaaagatgatcccgaattccacaaggagctc
gccacgctcaataagcgctatgtgggacgtccttcaccgctcaccgaggcgccgcgattc
gccgaacgcatcaaggaacgcaccggactcgacgccagagtgttcctcaagcgtgaggac
ctcaaccataccggtgcccataagatcaataatgcgatcgggcaggcactgctcgtcaag
cgcatgggcaagacccgcgtgatcgcggagaccggagcaggacagcacggcgttgccacg
gccaccgtgtgtgcgatgctcggtctcaagtgccgcatctacatgggacagatcgacgca
cggcgacaggcgctcaacgtggcccgcatgcgcatgctgggcgccgaggtggtcgaagtg
acacttggtgaccgtattctcaaggacgccatcaacgaggcgctgcgtgattgggtcacc
aacgtcaaagacacccactatctgcttggtaccgtcgcaggtccccatccgttcccggag
atggtgcgtgactttcagaagatcataggtgaggaggcgaaggagcagctggcacagtgg
tacggcatcgatcatcccgatgcgatctgcgcctgcgtgggcggcggttccaatgccatc
ggcatcatgaacgccttcctcgacgatccgcgcgtcaacctctatggtttcgaggctggc
ggccacggtccggactccggccagcatgccatccgtttcgcaccgggaaccggtgaactc
ggcatgttccagggggccaaaagctatctgcttgggaactctgagggacagacccttgac
acctactcgatttccgcaggccttgattatgcgtccgttggcccagaacacgcatggctc
aaggaaatcggacgtgtgaactattcatgggcgaccgatgaggaagcgatgaacgcgttc
aaggatctgtgcgagaccgagggcatcattccagccatcgagagctcccatgccgtcgcc
ggcgcctataaagcggcacgggatctcaaggagaagggctatgagcatccggtgatgatt
gtgaacatctcgggacgcggcgacaaggacatgaacaccgccggcaagtggttcggatat
ctcaccgatgagcaggcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtga

DBGET integrated database retrieval system