KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00342Help
Entry
BALAC2494_00342   CDS       T01842                                 

Definition
Tryptophan synthase (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BALAC2494_00342
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALAC2494_00342
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BALAC2494_00342
Enzymes [BR:bnm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BALAC2494_00342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917137..919356
Genome map
AA seq 739 aa AA seqDB search
MRRAVCRRREGTDHDSDVDMRSSPAFRYSDYDGKGPLSHRIPRRSMSVLDELVAGALEDK
CDRERVTSLEELKARAASAPAPLDAKRWLRRHDGIPVIAEIKRASPSKGHLIDIEDPAAL
GRQYEQGGASAISVLTEGRRFLGSLDDVDAVRAAVHIPVLRKDFITTDYQIWEARAHGAD
IVLLIVAALDDTQLAHLLKLTHELGMTALVETHTREEIERAIAAGARVIGINARNLKDLR
VDVGKYTELASNLPEDVIKVAESGVFGAVEVEDYARAGADAVLVGEGVATADDPRLAVER
LVKAGERVKASETTPLSEHHGPYWGQFGGRYVPEALITALDELQRVYDDAKDDPEFHKEL
ATLNKRYVGRPSPLTEAPRFAERIKERTGLDARVFLKREDLNHTGAHKINNAIGQALLVK
RMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQALNVARMRMLGAEVVEV
TLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPEMVRDFQKIIGEEAKEQLAQW
YGIDHPDAICACVGGGSNAIGIMNAFLDDPRVNLYGFEAGGHGPDSGQHAIRFAPGTGEL
GMFQGAKSYLLGNSEGQTLDTYSISAGLDYASVGPEHAWLKEIGRVNYSWATDEEAMNAF
KDLCETEGIIPAIESSHAVAGAYKAARDLKEKGYEHPVMIVNISGRGDKDMNTAGKWFGY
LTDEQAAALEANGATGNNA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgagccgtatgtcgccggcgagaaggaacagaccacgattcagacgtcgacatg
cgttcgtcacctgcattccgttacagtgactatgacgggaagggcccgttgagccatcgc
atcccaaggaggagcatgtcggttttggatgaactggtagcgggggcactcgaagacaag
tgcgaccgtgaacgcgtaacgtcgttggaagagctcaaggcccgggctgcctcggctccg
gctcccctcgacgcgaaacgatggcttaggcgtcacgacggcattccggtgattgccgaa
ataaagcgtgcctcgccgtcgaaagggcatctcatcgatatagaagaccctgccgctttg
ggccgacaatacgaacaaggcggtgcgagcgcaatctcggtgctcactgaaggccgcagg
ttcctcgggtctcttgacgatgtcgatgccgtacgtgccgctgtgcacatcccggtgctt
cggaaggatttcatcaccacggattaccagatctgggaggcgcgtgcgcatggggcggac
atcgtgctgctcatcgtcgcggcgcttgacgacacccagctggcgcatctgctgaagctc
acgcatgaactcggtatgaccgccttggtcgaaacgcatacccgtgaggaaatcgagcgg
gccatcgcggccggcgcgcgtgtgatcggcatcaatgcgcgcaatctgaaggatttgcgc
gtcgatgtgggcaaatacaccgagttggcgagcaatctgcccgaagatgtgatcaaggtg
gccgagtccggtgtattcggtgccgttgaagttgaggattatgcccgcgccggagccgac
gctgttctggtgggagagggcgtggccaccgccgatgacccgcggctggccgtggaacga
ttagtgaaggcaggagaacgagtgaaagcttctgaaaccactccgttgagcgaacatcat
ggcccgtattgggggcagttcggcggtcgctatgtgccggaggcgcttatcaccgccctc
gatgaattgcagcgtgtgtacgacgacgcgaaagatgatcccgaattccacaaggagctc
gccacgctcaataagcgctatgtgggacgtccttcaccgctcaccgaggcgccgcgattc
gccgaacgcatcaaggaacgcaccggactcgacgccagagtgttcctcaagcgtgaggac
ctcaaccataccggtgcccataagatcaataatgcgatcgggcaggcactgctcgtcaag
cgcatgggcaagacccgcgtgatcgcggagaccggagcaggacagcacggcgttgccacg
gccaccgtgtgtgcgatgctcggtctcaagtgccgcatctacatgggacagatcgacgca
cggcgacaggcgctcaacgtggcccgcatgcgcatgctgggcgccgaggtggtcgaagtg
acacttggtgaccgtattctcaaggacgccatcaacgaggcgctgcgtgattgggtcacc
aacgtcaaagacacccactatctgcttggtaccgtcgcaggtccccatccgttcccggag
atggtgcgtgactttcagaagatcataggtgaggaggcgaaggagcagctggcacagtgg
tacggcatcgatcatcccgatgcgatctgcgcctgcgtgggcggcggttccaatgccatc
ggcatcatgaacgccttcctcgacgatccgcgcgtcaacctctatggtttcgaggctggc
ggccacggtccggactccggccagcatgccatccgtttcgcaccgggaaccggtgaactc
ggcatgttccagggggccaaaagctatctgcttgggaactctgagggacagacccttgac
acctactcgatttccgcaggccttgattatgcgtccgttggcccagaacacgcatggctc
aaggaaatcggacgtgtgaactattcatgggcgaccgatgaggaagcgatgaacgcgttc
aaggatctgtgcgagaccgagggcatcattccagccatcgagagctcccatgccgtcgcc
ggcgcctataaagcggcacgggatctcaaggagaagggctatgagcatccggtgatgatt
gtgaacatctcgggacgcggcgacaaggacatgaacaccgccggcaagtggttcggatat
ctcaccgatgagcaggcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtga

DBGET integrated database retrieval system