KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00614Help
Entry
BALAC2494_00614   CDS       T01842                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bnm00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bnm00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604480..605889
Genome map
AA seq 469 aa AA seqDB search
MGCPVRLASNSENDCKGVVMAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKD
WLRFGVAWWHTFDAPLTDPFGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFC
FHDRDIAPEGDTLRETNANLDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPF
ADVYAYAAAQLKHSLEIGKRLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADY
AKQIGMDAQFLIEPKAKEPTTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTY
QHEIRVARDNGVLGSLDANQGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNF
DAKPRRTSFSAEDLFRAHIAGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSI
DDGTATLESLNDYAIDMPQSEIIASTHPDHLEDVKATINNYIIDALANA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgggatgcccggtgcgactcgcgtcgaacagtgaaaatgattgcaaaggagtagtcatg
gcaggtctgtgggacatcgacaagatcgagtatgtcggtcgcaccaaggggcttcaggag
ggactcggcttccagtattatgacgccgacaaagtggtcgccggcaagaagatgaaggac
tggctgcgcttcggcgtcgcatggtggcacaccttcgacgcgccgctcaccgaccccttc
ggtgacggcaccgcccagcgcccgtgggatggcaagtattccgacccgatggacaacgcg
ctcgccaaggtggactacgcgttcgagttcttcaccaagctcggcgccgagtacttctgc
ttccatgaccgcgacatcgccccggaaggcgatacgctgcgcgagacgaacgccaacctc
gaccgcgtggtcgacaagatcgaagagaacatgcagtccaccggcgtgaagctgctgtgg
aacacctcgtcgctcttcaccaacccgcgcttcgtggcgggcgcctccacctcgccgttc
gccgacgtctacgcctatgccgcggcgcagctcaagcactccctcgagatcggcaagcgc
ctgggcgccgagaactacgtgttctggggcggccgcgaaggctacgagaacctgtgggtc
accgacatgaagcgtgagcaggagcacatggcgaagttcttccacatgtgcgccgactac
gccaagcagatcggcatggacgcccagttcctcatcgagccgaaggccaaggaaccgacg
acgcaccagtacgacttcgacgcggccacggcatgcaacttcctgcgcgcctatgacctg
atcgacgtcttcaagctcaacctcgaaggcaaccacgcgaacctcgccggccacacctac
cagcacgagatccgtgtcgcgcgtgacaacggcgtgctcggttcgctcgacgccaaccag
ggcgacatgctgcttggctgggatctcgacgagttcccgaccaacctgtacgagaccacc
tccgtgatgtgggaagtgctcgatgaaggccagatcggccctcacggcggcctcaacttc
gatgccaagccgcgccgcacctcgttcagcgccgaagacctgttccgcgcgcacatcgcc
ggcatggactcgttcgccgccggcctgctcgtggcagacaagatgcatcaggacaagtac
atcgaggacctcgtggccaatcgttacggctcctacgattcgggcatcggtaagtcgatc
gacgacggcaccgcgaccctcgaatcgctcaacgactacgccatcgacatgccgcagtcc
gagatcatcgcatccacgcaccccgatcacctcgaggacgtgaaggcgaccatcaacaac
tacatcatcgacgccctggccaacgcctga

DBGET integrated database retrieval system