KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00661Help
Entry
BALAC2494_00661   CDS       T01842                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bnm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bnm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545659..546342
Genome map
AA seq 227 aa AA seqDB search
MESGSSRSGYHEPVPGSAGPEVFEDDWGDDFPKTFSVNLIWAQANDKEGRSGAIGYEGEM
PWHLPEDLKRFKELTVSHPVIMGRKTWEALNEKFRPLPNRDNIVLSRDRDFRAPGATVVD
NLEEALDMARQEAIPDDGLDRSEIWVIGGSQLFNQMLPMASKIYMTQVDAKVNADAYAPD
LTEALNNGSWKLMENSGWLTPKKPEGIDRYRYLTFERNTGDEQAEEE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggaagtagccgcagtggctatcacgaacccgtgcccggatccgccgggcca
gaagtcttcgaggatgactggggagatgatttccccaagacgttctcggtgaatctcata
tgggcacaggcaaacgacaaggaaggccgttccggtgccattgggtatgagggtgagatg
ccctggcatctgcctgaagacctgaagcgattcaaggagctcaccgtctcccatccggtg
atcatggggcgcaagacctgggaggcgctcaacgagaagttccggccgcttccgaaccgt
gacaacatcgtgttgtcgcgtgaccgtgatttccgtgcgccgggtgccaccgtggtggac
aatctggaggaggcgctcgatatggcccgtcaggaggccattcccgacgacggactcgac
cgcagcgagatctgggtcatcggcggctcccagctgttcaaccagatgttgccaatggca
tccaagatctacatgacgcaggtcgacgccaaggtgaatgcggacgcctacgctccagac
ctcaccgaggcgctcaacaacggttcctggaaactcatggagaattcgggatggctcacg
ccgaagaagcccgaaggcatcgatcgttaccgttacctgacgttcgaacgcaataccggc
gacgaacaggccgaagaggaataa

DBGET integrated database retrieval system