KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00661Help
Entry
BALAC2494_00661   CDS       T01842                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BALAC2494_00661
   00670 One carbon pool by folate
    BALAC2494_00661
Enzymes [BR:bnm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BALAC2494_00661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545659..546342
Genome map
AA seq 227 aa AA seqDB search
MESGSSRSGYHEPVPGSAGPEVFEDDWGDDFPKTFSVNLIWAQANDKEGRSGAIGYEGEM
PWHLPEDLKRFKELTVSHPVIMGRKTWEALNEKFRPLPNRDNIVLSRDRDFRAPGATVVD
NLEEALDMARQEAIPDDGLDRSEIWVIGGSQLFNQMLPMASKIYMTQVDAKVNADAYAPD
LTEALNNGSWKLMENSGWLTPKKPEGIDRYRYLTFERNTGDEQAEEE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggaagtagccgcagtggctatcacgaacccgtgcccggatccgccgggcca
gaagtcttcgaggatgactggggagatgatttccccaagacgttctcggtgaatctcata
tgggcacaggcaaacgacaaggaaggccgttccggtgccattgggtatgagggtgagatg
ccctggcatctgcctgaagacctgaagcgattcaaggagctcaccgtctcccatccggtg
atcatggggcgcaagacctgggaggcgctcaacgagaagttccggccgcttccgaaccgt
gacaacatcgtgttgtcgcgtgaccgtgatttccgtgcgccgggtgccaccgtggtggac
aatctggaggaggcgctcgatatggcccgtcaggaggccattcccgacgacggactcgac
cgcagcgagatctgggtcatcggcggctcccagctgttcaaccagatgttgccaatggca
tccaagatctacatgacgcaggtcgacgccaaggtgaatgcggacgcctacgctccagac
ctcaccgaggcgctcaacaacggttcctggaaactcatggagaattcgggatggctcacg
ccgaagaagcccgaaggcatcgatcgttaccgttacctgacgttcgaacgcaataccggc
gacgaacaggccgaagaggaataa

DBGET integrated database retrieval system