KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00671Help
Entry
BALAC2494_00671   CDS       T01842                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALAC2494_00671
   01230 Biosynthesis of amino acids
    BALAC2494_00671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALAC2494_00671
  Energy metabolism
   00680 Methane metabolism
    BALAC2494_00671
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALAC2494_00671
Enzymes [BR:bnm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BALAC2494_00671
Exosome [BR:bnm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BALAC2494_00671
  Exosomal proteins of melanoma cells
   BALAC2494_00671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529699..530634
Genome map
AA seq 311 aa AA seqDB search
MWPSGNTVAPCGICRGSRSPSRWCSSVSPCPSECAEIVAFADYPANRADMAMHVHLTRRV
ARLGHMTYKLVLLRHGQSEWNKTNQFTGWVDVPLTEKGREEAKNGGKLMKDKGVLPDIVF
TSLLRRAINTANIALDEADRLWIPVKRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWR
RSYGTPPPEIDPNDQYAQNNDPRYAGDPVPEAECLADVVARVEPYWEAEIIPELKSGKTV
LIAAHGNSLRAIVKMLDGLTEEEIAKVNIPTAIPLVYELDENFKPIKKGGEYLDPEAAAA
GAAAVAAQGQK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtggccaagcgggaataccgtagcgccatgcggaatctgtcgtggatcgcgctcgccg
tcgcgctggtgttcgtcggtctcaccatgtccatctgaatgcgctgagatcgtcgcgttc
gcagattatcccgccaatcgggcagatatggcaatgcacgtgcatttgactcgacgggtc
gctagactagggcatatgacttacaaactggtactgctccgacatggtcagagcgaatgg
aacaagacaaatcagttcaccggctgggttgacgtcccgctgaccgaaaagggccgcgag
gaagccaagaacggcggcaagctcatgaaggacaagggtgtgctgcccgacatcgtcttc
acctcgctgctgcgccgcgccatcaacaccgcgaacatcgcgctcgatgaggccgaccgc
ctgtggattcccgtgaagcgcgactggcgcctcaacgagcgtcactacggtgctctgcag
ggcaagaacaagaccgagatccgcgaggagtacggcgacgagaagttcatgctgtggcgc
cgctcctacggcaccccgccgcccgagattgacccgaacgaccagtacgcgcagaacaac
gacccgcgttacgccggcgacccggttccggaagccgagtgcctcgccgacgtcgtcgcc
cgcgtcgagccgtattgggaagccgagatcatcccggagctcaagagcggcaagaccgtg
ctcatcgccgcccacggcaattcgctgcgtgcgatcgtcaagatgctcgacggcctgacc
gaagaggagatcgccaaggtgaacatcccgaccgcgattccgctggtctatgagctcgac
gagaacttcaagccgatcaagaagggtggcgaatacctcgatcctgaggccgctgccgcc
ggtgccgccgctgttgcggcccagggccagaagtga

DBGET integrated database retrieval system