KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00754Help
Entry
BALAC2494_00754   CDS       T01842                                 

Definition
hypothetical protein
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Benzoate degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bnm01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bnm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bnm00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bnm00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bnm00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bnm00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bnm00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bnm00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bnm00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
463532..466351
Genome map
AA seq 939 aa AA seqDB search
MRQLTSREICATGRTDLPNLQEVRMADKNSAETATKAAKLAVNVEDKKAAAQAEVDALVR
KAQKALAEFEKLDQQAVDRIVAKASVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACE
HVTNYMAGQKTVGIIREDDVLGIDEVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPI
VFGFHPGAQKSSVEAARIVRDAAIEAGAPENCVQWIEHPSIEATGALMQHPGVATILATG
GPGMVKAAYSSGKPALGVGAGNAPAYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIA
HKDIYAPLVKELKRRKAYFVNDEEKAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHE
AGFEIPEDATILAAECSEVGENEPLTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHT
AAIHTNNDDLVREYGLRMHACRIIWNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGN
VQAINLLNIKRIARRNNNMQWFKIPAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGI
VDKVIDQLRARSNRVTFRIVDYVEPEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAA
KIMWLLYEHPEIAFSDVREKFFDIRKRAFKIPPLGTKAKLVCIPTSSGTGSEVTPFAVIT
DHKTGYKYPITDYALTPSVAIVDPVLARTQPRRLASDAGFDALTHSMEAYVSVYANDFTD
GMALHACKLIWDNLAESVNSEPGETKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAHTIG
ALCHIAHGRTNSILLPYVIRYNGQVPEEPTSWPKYSKYIAPERYQELASLLGVDPGKTPA
EGVENLAKAVEDYRDNKLGMNKSFKDCGVDEDYFWSILEQIGMRAYEDQCAPANPRIPQI
QDMMDIAIAAYYGVSQAEGHAMRVEREGVGATEEASERV
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaactcacatctcgtgaaatctgcgccacggggcgcaccgatttgccgaatcta
caggaggttcgcatggcagacaagaacagcgccgagaccgcaacgaaggcggccaagctt
gctgtgaatgtggaagacaagaaggccgcggcacaggccgaggtcgacgctctggtcagg
aaggcgcagaaggcgctggcggaattcgaaaagctcgatcagcaggccgtcgatcgcatc
gtggcgaaggcctccgtggccgccctcaacaagcatctggtgctggcgaaactggcagtc
gacgagaccggtcgtggactcgtcgaagacaaggcgacgaagaacatcttcgcctgcgag
cacgtgaccaattacatggccggtcagaaaaccgtcggcatcatccgcgaagacgacgtg
ctcggcatcgacgaagtggcagaaccggtcggcgtcgtcgcaggcgtcaccccggtgacc
aacccgacgtccactgccatcttcaagtcgctcatcgccctcaagacccgttgcccgatt
gtcttcggcttccacccgggagcgcagaagagctccgtcgaagcggcgcgcatcgtgcgt
gacgccgccatcgaggcaggtgccccggagaactgcgtgcagtggatcgaacacccgtcc
atcgaggcgaccggcgcgctcatgcagcatcccggcgtggccacgatcctcgcgaccggc
ggccccggcatggtcaaggccgcgtactcgtccggcaagccggccctgggcgtcggcgcc
ggcaatgccccggcctacgtcgacaacaacgtcgacgtgcagcgcgtggcgaacgacctc
atcctctcgaagcacttcgactacggcatgatctgcgccaccgagcaggcgatcatcgcg
cacaaggacatctacgcaccgctcgtcaaggaattgaagcgccgcaaggcatacttcgtc
aacgacgaggagaaggccaagctcgagaagtacatgttcggctgcaccgcgttctccggc
gagaccccgaagctcaactccgtggtcccgggcaagtctccgcagtacatcgcgcacgaa
gccggcttcgaaatccccgaggacgccacgatcctcgctgccgaatgctccgaggtgggc
gagaacgagccgctcaccatggagaagctggcgccggtgcacgccgtgcttaagttctcc
gacaaggagcagggcttcgaaatgtgcgaggagatgctcaagcacggtgccggccatacc
gccgcaatccacacgaacaacgacgacctcgtccgcgagtacggcctgcgcatgcacgcc
tgccgcatcatctggaaccagccgagctcgctcggcggcattggcgacatctacaactcc
atcgccccgtcgctcacgctgggctgcggttcctacggtggcaactccgtctccggcaac
gtgcaggcgatcaatctgctcaacatcaagcgaatcgcgcgaaggaacaacaacatgcag
tggttcaagatcccggcaaagacgtacttcgagccgaacgccatcaagtacctgcgcgac
atgtatggcatcgagcgtgccgtcatcgtgtgtgacaaggtgatggagcagctcggcatc
gtcgacaaggtgattgaccagctgcgtgcacgctccaaccgagtcaccttccgcatcgtc
gactatgtggagcccgagccgagtgtcgagaccgtcgagcgcggcgccgccatgatgcgc
gacgaattcgagccggacacgatcatcgccgtcggcggtggctctcccatggacgccgcg
aagatcatgtggctgctctatgagcacccggaaatcgcgttctccgacgtgcgtgagaag
ttcttcgacattcgcaagcgcgctttcaagattccgccgctcggcaccaaggccaagctt
gtgtgcatcccgacctcgtcgggcaccggctccgaggtcacgccgttcgctgtgatcacc
gaccacaagaccggctacaagtacccgatcaccgactacgcgctcacgccgtccgtcgcg
atcgtcgacccggtgctcgcgcgcacgcagccgcgccgactggcctccgatgccggcttc
gatgcgctgacccattcgatggaggcctacgtctccgtctatgcgaacgacttcaccgac
ggtatggcgctgcatgcctgcaagctgatctgggacaaccttgcggagtccgtcaatagc
gagccgggcgaaaccaagaagaaggcgcaggagaagatgcacaacgccgccaccatggcc
ggcatggcattcggatccgccttcctcggtatgtgccacgccatggcgcacaccatcggc
gccctgtgccacatcgcgcacggccgcacgaactcgattctgctgccatatgtgatccgc
tacaacgggcaggtgccggaggagccgacctcctggccgaagtacagcaagtacatcgcg
ccggagcgttaccaggagctcgcctcgctgctcggggtcgacccaggcaagaccccggcc
gagggtgtcgagaatctggcgaaggccgtcgaggactaccgcgacaataagctcggcatg
aacaagagcttcaaggattgcggtgtggatgaggactacttctggagcatcctcgagcag
atcggcatgcgcgcctatgaagaccagtgcgcgcctgcgaatccgcgcatcccgcagatc
caggacatgatggatatcgccatcgccgcctactacggcgtctcgcaggcggagggccat
gcgatgcgcgttgagcgcgaaggcgtgggcgccacggaggaagcctccgagcgcgtctga

DBGET integrated database retrieval system