KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00759Help
Entry
BALAC2494_00759   CDS       T01842                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BALAC2494_00759
Enzymes [BR:bnm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BALAC2494_00759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455773..458001
Genome map
AA seq 742 aa AA seqDB search
MLLYGRSRERRCEKGLHLGVMAELNEESPERLARPLIRLAQSLGVATSYVGMSRDFHEIP
DDVLVAVLKALNVDASSEETIEVSLEHVNNQRAMRLIEPTVLHIVGEQSHVPIHLAITEA
PKVTITLEDGTIYQHDIAVEPLPDVKVHEVNGKFFSTAQIALPADLPEGYHTLHIAAGQR
EADATLISAPQRIPLLDPLKNGSLWGWMAQLYSIRSADSWGVGDFADLRTLLIDSKRYTN
ADFMLINPVHAGEPVSPLTPSPYLPVSRRFINYTYIHPEDIPEYYALDDAAKQSVKDAHA
KMEAYNADPNLIDRDAMWLEKEKALRTIFNTGLQSVRQQAFDDYKARCGEDLEAYATWCV
CYAKWGKPENTPDNWINKYTKDSPEVKQLREQNSDLLEFYRWLEWIAVEQMHAAQQAARQ
AGMKIGIMSDMAVGVHPDGSEVWWNPERFANGATVGAPPDMFNQQGQNWSQPPLSPLSLK
ETGYKAYREMVRGMFDCAGAVRIDHILGLFRLWWIPEGQPASNGTYVYYDHNTMLGILAI
EADRVGGLIVGEDLGVVPSYVQQSLADYAIFGCAVEWFEQMDGVFIPPKDWRPYALASVD
NHDMPPAAGYLEYEHVRVREQLGLLGEDSSAFERSARAEHQAMLQMLVDNGYLDVNVMKD
ESGRWEEIVEALYRALNSSPCKLKAVSFVDAVGERRTQNQPGTDNEYPNWRVPLADYHGD
NVPLEHLFDSDLLQRIAKIMNS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
ttgctcctttatgggcgtagccgggaacgtcgctgcgaaaaaggcttacacttaggagtt
atggcagaactcaacgaagaaagcccggagcgtcttgcgcgcccccttattcgtctcgcg
cagtcgctgggcgtggcgaccagttatgtcggcatgtcgcgtgatttccatgagattccc
gatgacgtgctcgtggccgtgctgaaggccctgaatgtcgatgcctccagcgaggagacc
atcgaagtgtcgttggaacatgtgaacaaccagcgcgccatgcggctcatcgaacccacc
gtgctgcacattgtgggcgagcagagtcacgtgcccatccatctggccatcaccgaggcg
ccgaaggtcacgatcacactcgaagacggcaccatataccaacacgacatcgcggtggag
ccgctgcccgacgtcaaggtgcatgaagtcaacggcaagttcttctcgacggcgcagatc
gcactgcctgccgacctgcccgagggctaccacacgctgcatatcgcggcagggcagcgc
gaggcggatgcgacgctgatcagcgcgccacagcgcatcccactgctcgatccgctcaag
aacgggtcgttgtggggctggatggcccagttgtattcgatccgctcggccgactcctgg
ggcgtcggcgatttcgccgatctgcgcacgttgctcatcgactcgaagcggtacacgaac
gccgacttcatgctcatcaaccctgtgcatgccggcgaaccggtctcaccgctgaccccg
tcgccatacctaccggtgtcgcgtcgcttcatcaactacacctacattcacccggaggac
attccggagtactacgcgttggacgatgccgccaagcagtccgtcaaggacgcgcacgcc
aagatggaggcctacaacgccgatccgaacctgatagaccgcgatgccatgtggctggag
aaagagaaggcgctgcgcacgatcttcaacacgggcctgcagtcggtgcgccagcaggcc
ttcgacgactacaaggccaggtgcggcgaggacctcgaggcatacgccacctggtgcgtc
tgctatgcgaagtggggcaagccggagaacacgccagacaattggatcaacaagtacacg
aaggattcccccgaggtcaagcagctgcgcgagcagaacagcgacctgctcgaattctac
cgttggctcgagtggattgcggtcgagcagatgcatgcggcccagcaggcggcacgtcag
gccggcatgaagatcggcatcatgagcgacatggctgtgggcgtgcatcccgacggctcc
gaggtgtggtggaacccggagcgattcgccaatggcgccaccgtgggtgcgccgccggac
atgttcaaccagcaggggcagaactggagccaacccccgttgagcccgctgtcgctcaag
gaaaccggctacaaggcgtaccgcgagatggtgcgtggcatgttcgactgcgccggtgct
gtgcgcatcgaccacattctcggcctgttccgcctgtggtggatcccggagggccagccg
gcctcgaatggcacctacgtgtactacgaccacaacacgatgctgggcattctcgcaatc
gaagcagaccgtgttggtggtctgatcgtgggtgaggacctcggtgtcgtgccgtcgtac
gtgcagcagtcgctcgccgactatgccatcttcggctgcgccgtcgaatggtttgagcag
atggatggcgtgttcattccgccgaaggattggcgcccgtatgcgttggcctcggtggac
aaccacgacatgccgccggctgccggctatctcgagtacgagcatgtgcgcgtgcgcgag
cagctcggtctgctcggcgaggattcgtcggccttcgagcgcagcgcgcgcgccgagcat
caggccatgctgcagatgctcgtcgacaacggctacctcgatgtcaatgtgatgaaagac
gaatccggcaggtgggaggagatcgtcgaggcgctctaccgtgcgctcaacagctcgcct
tgcaagctcaaggccgtctccttcgtcgacgcggtgggagaacgccgcacgcagaaccag
ccgggcaccgacaacgagtatccgaactggcgtgtgccgttggccgactaccacggcgac
aacgtgccgctcgagcacctgttcgactccgatctgctgcagcgcatcgccaagatcatg
aacagctga

DBGET integrated database retrieval system