KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00823Help
Entry
BALAC2494_00823   CDS       T01842                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bnm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bnm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375211..376356
Genome map
AA seq 381 aa AA seqDB search
MSGAMQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVGAIAQVRMLGGN
IVLVSSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFGRYGIRVGQLLIT
AEDTMQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDRLSALIANMVRADA
LILLTDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVGTGGMVTKLEAARMA
AVSGIPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFAAHPRGVLVADSGAAK
AVRGGRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGYDSEEIPNMLGRNTAQL
RRLLGEEYAHPLVHRDNLVLV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggagctatgcagaccccgtcccaggaggaagtacgccgggcggtggcagccgcg
cgaaccgtggtggtgaaggtggggtcgagctcgctcacgcagccgtccgggcacttggac
gtagacaagctcaatgcgctggtgggcgcgatcgcgcaggtgcgcatgctcggcggcaac
atcgtgctcgtctcgtccggcgccatcgccgcgggtttcggtccgctcggcttcgaatcg
cgccccaccgatgtggccacacagcaggcgaccgcgtcggtggggcaggggctgctcatg
gcccagtacgagatggcgttcggccgctacggcattcgcgtgggccagctgctcatcacc
gccgaagacacgatgcagccacggcagtaccgcaatgcgcggcgcaccatggccaagctg
ctcgaactcggtgtggtgccgatagtcaacgagaacgatgcgcttgccagcaacgagatc
cgtttcggcgacaacgaccggctttccgcgctcatcgcgaacatggtgcgtgccgacgcg
ctgattctgctcaccgatgtcgacgcgctctacaccgcacccccaagcgaaccgggctcc
catagaatcggcttcgtgccgaacatcaccgaactgctcgatcaggtgcgtgtgggcggt
tcagagtcgggcgtgggcaccggcggtatggtcacgaagctcgaggccgcgcgcatggcc
gccgtctccggcattccggccgtgctcaccgccgcccgcaacgccggtccggcactcatg
ggcgatgaggtgggcacggcattcgctccggtgaagcaacgcggttcggcgcgcaggttg
tggatcaaattcgcggcccatccgcgtggagtgctcgtggccgattccggcgcggccaag
gcggtgcgcggcggacgggcgagtctgcttgctgcgggtgtgctcgaatcgcgtggtgat
ttcgccgccggcgacccggtgtggatcgacgacgaggcgggcaatcatctggcgcgcggc
cttgccggttacgattccgaggagattccgaatatgctcggacgcaacaccgcacagctg
cgccgcctgcttggcgaggaatatgcgcacccgctcgtgcaccgcgacaatctcgtgctc
gtgtga

DBGET integrated database retrieval system