KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_01028Help
Entry
BALAC2494_01028   CDS       T01842                                 

Definition
(GenBank) Lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BALAC2494_01028
Enzymes [BR:bnm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BALAC2494_01028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S28 Peptidase_S9 LIDHydrolase Ser_hydrolase PGAP1 DLH Abhydrolase_8 Thioesterase Esterase DUF900 THDPS_N_2
Motif
Other DBs
NCBI-ProteinID: AEK29536
Position
complement(107460..108545)
Genome map
AA seq 361 aa AA seqDB search
MEIAMINEHEFQQDLEATALPALDSCMHDGYMDPAVSDWHGHRLRTLHPADGTPNKLHVV
RYDVEKFHALQIPGSSRQTHGTVLISHGFTEFAAKYKEMAWYFLLAGFSVCILEHRGHGY
SARDVRNDQIVYIDTWHRYVADLAKCARTIARPMAADKPLVLFAHSMGGGIAAAMLERYP
NIVDKAVLSSPMIEANLHTPNWLAALVCGAACDFGHAKSMAPGQRAFTPLIDIKDNQGAC
MQRLEWMKKLRIADTHYQTSAAANEWVRQAIRLSIAMQDPHMCERIETPILLFQAGNDHW
VRNKAQNRFVKRVGKDGGDIRMVRVPGSVHEIFTMPNSVMAPYLKEILTFLQTSEPVTVL
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgcgatgatcaacgaacacgaattccagcaggatctcgaggccaccgccctg
ccggccctcgattcgtgcatgcatgacggctacatggacccggccgtctcggattggcat
gggcacagactgcgcacgctgcacccggcggacggcactccgaacaagctgcatgtcgtg
cgctacgacgtcgagaaattccatgccttgcagattcccggctcctcccgccaaacccat
ggcaccgtgctcatctcgcacggattcaccgagttcgcggccaaatacaaggagatggca
tggtacttcctgctcgccggattctccgtttgtattctcgaacaccgcgggcatggctat
tccgcgcgcgatgtgaggaacgaccagattgtgtacatcgacacatggcaccgctatgtc
gccgatctcgcgaaatgcgcgcggacgatcgcacgcccgatggcggcagacaagccgctt
gtgctgttcgcacattcgatgggcggcggcatcgcagcggccatgctcgagcggtacccc
aacatcgtcgacaaggccgtgctgtcgtcgccgatgatcgaggcgaatctgcacaccccg
aactggctcgcagcactggtgtgcggcgcggcatgcgatttcggccacgccaagtccatg
gcacccggacagcgcgcgttcacgccgctcatcgacatcaaagacaaccagggcgcatgc
atgcagcgtctcgaatggatgaagaagctgcgcatcgcagacacgcattaccagacctcg
gccgcggcgaacgagtgggtgaggcaggcgatccgcctgtccatcgccatgcaggacccg
catatgtgcgagcgcatcgagacgccaatcctgctgttccaggcaggcaatgaccactgg
gtgcgcaacaaggcgcagaatcgcttcgtcaaacgcgtgggcaaggacggcggcgacatc
cgcatggttcgcgtgcccggctccgtgcatgagatcttcacgatgccgaacagcgtgatg
gcaccgtatctgaaggagatcctcacgttcctgcaaacgagcgagccggtcaccgtgctc
gtctga

DBGET integrated database retrieval system