KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_01067Help
Entry
BALAC2494_01067   CDS       T01842                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bnm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(55376..57535)
Genome map
AA seq 719 aa AA seqDB search
MPPHRSPCTTHSGTKERHMARAYTDPILFGAAYYDEYIPRDLDRIDTDMEMMTRAGINVI
RIGESTWSTCEPQPGHFDWTHIDRALDAATNAGINVIVGTPTYAVPTWLVAMYPDVLATT
PAGEPHYGARQIMNIVNPAYRLYGERVIRSLISHVAQQPCVIGYQVDNETKYYDSVSHDM
QVMFIKQLRHEFKNDLEALNEAYGLDYWSNRINAWEDFPDLTGSINESLRARFDRFRRDQ
VAEYLAWQASIIREYMRDDQFITHNFDYEWRGHSYGLQPAVDHFRAARALDICGVDIYHP
SEDALTGKEIAFGGDMARSAGGGNYLVLETQAQGQHGWLPYPGQLRLQAYSHLASGADGI
MYWHWHSIHNSFETYWRGLLSHDFESNPTYEEAGRFGREIGDPRIGDTLSHLSKRNAVAI
LASNESLTALSWFHIETGFPMGGTLTYNDVLRSIYDALFELNVEVDFLPADASADQLAGY
SLVIAPALYTTDQQTIDRLARYVKNGGHLLATMRSFVADENVKVWHDKAPHHLVDIFGMT
YNQFTRPMGVSLKCPDTLADLAGASANDFIEMLSPAPETHVLAWYDHYAWDSYAAITRHA
FGSGDAQWVGTQLQADAWRTVLAEALSNAGVHTPGMELAGTVCVRSGTNTAGDTVTYLLN
YSGSPITFRAPASGTFLLGHPTDDGEQAVTAETPVTVGDAVTLPRWGVDIIVGRQPTMN
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccgccccaccgttcaccttgcacaacacatagcggaaccaaggagagacacatggcc
cgcgcatacaccgaccccattctgttcggcgcagcatactatgatgaatacatcccgcgc
gatctggatcgcattgacaccgacatggagatgatgacccgagcgggcatcaacgtcatt
cgcatcggcgaatccacgtggtccacatgcgaaccccagcccgggcatttcgactggacg
cacatcgaccgcgcgctcgacgcggcgaccaacgccggaatcaacgtgattgtgggaacc
ccgacctatgcggtacccacatggctcgtcgccatgtatccggacgtccttgccaccaca
ccggccggggaaccccactacggggcgcggcaaatcatgaacatcgtcaacccggcctac
cgcctttacggcgagagggtgatccgatccctcatctcccacgtggcacagcagccttgc
gtcatcggctatcaggtagacaatgagacgaaatactacgattccgtctcccacgacatg
caggtgatgttcatcaaacaactacgccacgaattcaagaacgacctcgaggcattgaac
gaggcgtacggcttggattactggtcgaatcggatcaatgcgtgggaggacttcccggat
ctcaccggttcgatcaacgagtcgttgcgcgcgcgattcgacaggttccgccgcgatcaa
gtggcggagtatcttgcatggcaggcgagcattattcgggagtatatgcgcgacgaccag
ttcatcactcataatttcgattacgaatggcgcggtcattcctatgggttacagcctgcg
gtcgaccatttccgtgccgcccgcgcactcgacatctgcggcgtcgacatctaccatccg
agcgaggatgcactcaccggcaaggagatcgcattcggcggcgacatggcacgttcggca
ggcggcggcaattacctggtgctcgaaacgcaggcacagggtcagcatggttggctgccg
tacccaggccaattgcgccttcaagcctacagtcatctcgcatccggtgcggatggaatc
atgtactggcattggcattcaattcacaattcgttcgaaacgtattggcgcggactgctg
tcgcacgatttcgagagcaatcccacctacgaggaggccgggaggtttggacgcgagatc
ggcgacccgcgtatcggagacacgctcagtcatctgtcaaaacgcaatgcggtggcaatc
ctcgccagcaacgagtcgctcaccgcgctgtcctggttccacatcgaaacgggattcccc
atgggcggcacgctcacatacaacgacgtgttgcgatccatatacgatgcattgttcgag
ctcaatgtggaggtcgatttcctgcccgcagatgcgagcgcagaccaactcgccggttac
tccctggtgatcgcacccgcattgtataccacggatcagcagaccatcgaccgattggcg
cggtatgttaagaatggcggtcatctgctcgccaccatgcggtcattcgttgcggacgag
aacgtgaaagtgtggcacgacaaggcaccgcatcatcttgtcgacatatttggcatgacc
tacaaccagttcactcgtccgatgggtgtatcgctcaaatgccccgacactttggccgac
ctcgccggcgcgtctgcaaacgacttcatcgagatgctctccccggctccggaaacccac
gtactcgcttggtacgaccattatgcctgggattcatatgcggcgatcaccagacatgca
ttcggttccggagatgcgcagtgggtgggcacgcagcttcaggcggatgcatggcgcacc
gtgcttgcagaggccctgtccaacgccggcgtgcacacccccggcatggaactggccggc
acagtctgcgtgcggagcggaaccaacacggcaggcgataccgttacctacctgctcaac
tattcagggtcgcccatcaccttccgggcacccgcctcgggaacgttcctgctgggacat
cccacagacgacggagagcaggccgtcaccgccgaaactccggtgaccgtgggcgatgcc
gtcacattgccgcgttggggagtggacatcattgtcggccggcaacccacaatgaattga

DBGET integrated database retrieval system