KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_01213Help
Entry
BALAC2494_01213   CDS       T01842                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bnm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bnm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bnm00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1814594..1816993)
Genome map
AA seq 799 aa AA seqDB search
MMLEHSRPALLDELTAPRNALKPDSKGRIVWGNGTVTLVFAVSDDRPVTLIGMSGRGMEP
VDANIAGEPDAQPIVELRSSLDGGGDNRLKLAVSSAGLKLRFVRAYELNRLGDERQPVTL
LAIVQRDPDGDGPLVTSVFEATAHTSAVRTYTRLCSEEPYPVEAVSSMNATLPMEAAKLE
DAQAQVYWGESSWDCENAWQSAPLRSTTLRDRNQVINPGMSSARFARRSTSTWSTGEFEP
MGIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRVSAYGPEYDDHQWFIMLRDN
QPFVTVPVSFVVCAGDWQHAVAEMTVQRRALYRAKAMEMGRLEQAEQAKGLVVYNDYMNT
LWGDPRIEKELPLVEGAAKVGADVFCIDAGWYDSEDGGWWDMVGEWKPSMNRFGDIRLAG
LIHDIQSHGMKAGLWLEPEVIGVRSPLAKMLPDSAFFCRHGVRIADQGRYHLDFRSPVAR
AHATATVDRLIDEFNVRFFKFDYNTTPGAGTDVDTDSVGEGLLEHCRAVQQWIEQIRAKH
PDVMIENCGSGAMRADYAMLSRLDMQSTSDQSDPLVYAAIAAGAGMTVLPEQQGNWGYAQ
QEMDDETAVFTLAAGILGRLYLSGFIDRMDEARLGLVRDAIALHRTILGGQSHLVPWWPC
GLPDFNSPWLVYGLRHAPNVTGLSHDEDWNGTDGQGSEHVDEAQYLTIWRRGGINSLYLE
IGEGAHIEQVFPNPAKPEHAPDAKPWRIEWADSETVRIEASADKEPSARVFAITFPQPSA
DGTADDDASENAGHDIEGR
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcttgaacatagccgccccgcattgttggacgagttgacggcgccccgcaacgcc
ttgaagccggattcgaaagggcgcatcgtatggggcaacggaacggtgacgctcgtcttc
gccgtgagcgacgacagaccggtgacattgatcggcatgagcggccggggcatggagccg
gtagatgcgaacatcgccggcgaaccggatgcgcagccgatcgtggaactgcgcagttcg
cttgacggcggcggggacaacagactgaagctcgccgtttcgtccgccggcctcaaactg
aggttcgtgcgggcatatgagctcaacagattgggcgatgagcgacagccggtcacgctg
ctcgcgattgtgcagcgcgacccggacggggacggcccgttggtgacgagcgtgttcgag
gccacggcgcacacgagcgccgtgcgcacctacacacggttgtgcagcgaggagccatat
ccagtggaggcggtgtcgtcgatgaacgcaacactgcccatggaagcggccaaactggag
gatgcgcaggcgcaggtctattggggagaaagctcgtgggactgcgagaacgcctggcaa
agcgccccgctgcgttccaccacgctgcgcgaccgcaaccaggtgatcaatccgggcatg
tcctccgcccgattcgcccgccgttccacctcgacgtggtccaccggcgaattcgagccg
atgggcatcgtcgaaggaggcggccgcccgggtgagctcggccatttctcattcgcatgg
cagatcgagcacaacggcgcctgggaatgggagatcggcgaggacgacccgggtctgcgc
gtgagcgcatacgggccggaatacgacgaccatcagtggttcatcatgctgcgcgacaac
cagcccttcgtcacggtgccggtctcgttcgtggtctgcgcgggcgactggcagcatgcc
gtggccgagatgaccgtgcagcggcgcgcgctctaccgggcgaaggccatggagatgggg
cgtctggagcaggccgaacaggcgaagggtctcgtggtctacaacgactacatgaacacg
ttgtggggagacccccgcatcgagaaggagctgccgcttgtggagggcgcggccaaggtg
ggcgccgacgtgttctgcatcgacgccgggtggtacgacagcgaggacggcggctggtgg
gacatggtgggtgaatggaaaccctccatgaaccgcttcggcgacatccgcctggccggc
ctcatccacgacatccagtcacacggcatgaaggccggcctgtggctggagccggaggtg
atcggcgtgcgctcgccgctggcgaagatgctgcccgactcggcgttcttctgccggcat
ggcgtccgcatcgccgatcagggccgctaccatctcgacttccgctcgccggtggcgcgc
gcccatgccacggccacggtggaccgcctgatcgacgagttcaatgtgaggttcttcaag
ttcgactacaacacgacgccgggtgccggcaccgatgtcgacacggattcggtgggcgag
ggcctgctcgagcattgccgcgcggtgcagcagtggatcgagcagatccgcgccaaacac
cccgacgtgatgatcgaaaactgcggttccggtgccatgagggccgactatgcgatgctg
agccgcctcgacatgcagtccacctccgaccagtccgatccactcgtctatgcggcgatc
gccgccggcgccggcatgacggtgcttccggagcagcagggcaactggggctatgcacag
caggagatggacgacgagaccgccgtgttcacgctggctgcaggcattctgggccgcctg
tacctctcggggttcatcgaccgcatggacgaggcgcggctgggcctggtgcgcgatgcg
atcgcactgcaccgcacgatcctgggcgggcaatcgcatctggtgccatggtggccctgt
gggttgccggacttcaacagcccttggctcgtgtatggtttgcggcatgcccccaatgtg
accgggctgtcgcatgacgaagactggaatggcactgacggccaaggctccgagcacgtc
gatgaggcccaatacctgaccatctggcgtcgtggcggcattaattcgctgtatttggag
attggtgagggagcccatatcgagcaggtgttccccaatccggccaagccggagcatgcg
cccgatgccaagccgtggcgcattgaatgggcggattccgagaccgtgcgcatcgaagcc
tccgcagacaaggagccctccgcacgtgtcttcgccatcacattcccgcagccatctgcc
gatggcacagcggatgacgatgccagcgagaacgccgggcacgatatcgaggggcgataa

DBGET integrated database retrieval system