KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_01320Help
Entry
BALAC2494_01320   CDS       T01842                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bnm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bnm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1672111..1673565)
Genome map
AA seq 484 aa AA seqDB search
MIQAFSTYANAQGTTLAAAFAPLGNAYLRVGRTPESTSHASTPTLSIDTTRVRQPIDGFG
ASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPSDHVSAPYRFVRRFPDR
NLNSLDFTPEMERVLPMVEAANDCALATQSHALNIMASPWSAPWWMKTNLSVLGKRRYTR
ITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDYPQSRWPSMAMTPREQAEF
VARHLRPMLDHAGLEGTRILCWDHNYSTDHYPDGAFVRDMYADSAALTACAGSAWHYYGG
SARTMSRIHDAFPNKGIWATEASGGDWGPRNFTPALLSLGTAVIDMMNNWARSAVLWNIA
LDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADYYALGHFSKYVPIGSRCVECAL
DHAQGVRAAAFLVPAALTHGDGDQVVAVLVNSRPEPLDLLCHLRGAGNGVMLTLPASSLT
SFLA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcattctcaacatacgcgaatgcgcagggcaccacgcttgccgccgcgttc
gcgccgcttgggaatgcctatttgcgtgtagggcgcacgccggagagcacgtcacacgcc
agcacccccacgctcagcatcgacacgactcgcgtgcgccagcccatcgacggcttcggc
gcatcgatcaccgaggcgacgagctggctgtggcacaatcgcgtcacagacaaagagcga
tgcatccgcgatctgttcagcccgcgcgacggcataggcatctcgatgctccgtcagcca
atcggcccaagcgaccatgtgagcgcgccgtaccgcttcgtgcgcagattccccgaccgc
aatctcaactccctcgatttcacacccgagatggagcgcgtgttgcccatggtcgaggcc
gcgaacgactgtgcgctcgccacgcaatcgcatgcgctcaacattatggcgagcccgtgg
agcgcgccatggtggatgaaaacgaatctcagcgtgctcggcaaacggcgctacacgcgg
atcaccggccatctgcggcgcggcatgtatgccgcctatgcgcgctatatcaccggtttt
gcgcgattgtatgcgcagcgcggactgccgctgttcgcgctcaccgtgacgaacgaaccc
gactacccgcagtcgcgatggccatcgatggcaatgaccccgcgcgagcaggcagagttc
gtcgcgcgccatctgcgccccatgctcgaccacgccggattggaaggcacgcgcattctg
tgctgggaccacaactactccaccgaccattatccggacggcgccttcgtgcgagacatg
tacgccgattccgccgcgctcaccgcctgcgccggctccgcatggcattattacggcgga
tccgcgcgcacgatgtctcgcattcacgacgcgtttccgaacaagggcatctgggcgacc
gaggcgagcggcggcgactgggggccgcgcaatttcacacccgcgctgctctcgctgggc
acggcggtcattgacatgatgaacaactgggcgaggagcgccgtgttgtggaacatcgcg
ctcgacgagcacggcggtcccgactactactacctgcgcaacgatcgccggcattccgag
aaccgtggtctgatcactgtgcgtgacgacggttcgatacgccgcaatgcagactactac
gcgctcggccacttctccaaatacgtgccgattggctcacgttgcgtggaatgcgcgctc
gaccatgcgcaaggtgtgcgtgccgccgccttcctagtccctgccgctcttactcatggt
gatggtgaccaggttgttgccgtgctcgtgaactctcgccccgagccgctcgacctgctg
tgccatctgcgcggtgcaggcaacggcgtgatgctgacattgccggcttcctccctcacc
tctttcctggcatga

DBGET integrated database retrieval system