KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_01692Help
Entry
BALAC2494_01692   CDS       T01842                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bnm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BALAC2494_01692
Enzymes [BR:bnm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BALAC2494_01692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740001..740642
Genome map
AA seq 213 aa AA seqDB search
MGGTMSEQSRQSQATERQGGRLIVLTGPTAVGKGTVETALRKAHPEVWVSVSATTRDPRP
GERDGVNYWFISEPEFLRRQEAGEFLETAVVHGMAHYGTPLEPVREHLAGNVPTILEIDL
QGARRVKERAKELGLDVVYVFIAPPSFDELKKRLIGRGTETPEQQAKRLETAKVELAAEP
EFDVTIVNEQVDKAARDLWNVIAQEYGLPQDTD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggaacaatgagcgaacaatcccggcaatcgcaggcaaccgagcggcaaggcggc
cggctgatcgtactcaccggccccacagccgtgggcaagggcaccgtcgagacggcgtta
cgcaaggcgcatccggaggtctgggtttcggtctccgccaccacgcgcgatccacggccg
ggggaacgcgatggcgtgaactactggttcataagcgaacccgaattcctgcgcaggcag
gaggcgggggagttcctcgaaaccgccgtcgttcatggcatggcgcactacggcacgccg
ttggaacccgtacgtgagcacttggcagggaacgtgccgacaatcctcgagatcgacctg
cagggtgcgcgccgcgtcaaggagcgcgcgaaggaactcggactcgacgtggtttacgtg
ttcatcgcgccaccaagcttcgacgagctcaagaaacgtctgatcgggcgtgggacggag
acgcctgaacagcaggcgaagcggctcgagaccgcgaaggtggagctggcggcggagccc
gagttcgatgtgacgatcgtgaacgagcaggtggacaaagcggcacgggacctgtggaat
gtcatcgcacaggaatacggcttgccacaggataccgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system