KEGG   Brassica oleracea (wild cabbage): 106312056Help
Entry
106312056         CDS       T04124                                 

Definition
(RefSeq) acid beta-fructofuranosidase 4, vacuolar
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106312056
   00500 Starch and sucrose metabolism
    106312056
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106312056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
C8
AA seq 663 aa AA seqDB search
MASSDALLPISAREEDPLLSAGSRSDPNAETHRRRRPVKGLLAVSFGLLFIAFYVVLIAT
HDGSSRSNDVKIESDETATTTSRARLAGVSEKSNGQLWKLSGERNTVSFAWNNSVLSWQR
TAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPIA
MVADQWYDANGVWTGSATFLDDGSLVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKYS
GNPVLVPPPGILPKDFRDPTTAWKTSDGKWRITIGSKINKTGISLVYDTIDFKTYEKHDT
LLHKVPNTGMWECVDFYPVSKTAVNGLDTSVNGPNVKHIVKASMDDTRFDHYAVGTYFDS
NGTWIPDDPTIDVGMSASLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGW
SSLQGIPRTVVLDTKTGKNLVQWPVEEIKSLRLSSKQFDMEVGPGSVVPVDVDSAAQLDI
EAEFEINKESLDKILGDASVLAEAEEFSCQKSGGASVRGALGPFGFSVLADKSLSEQTPV
YFYVAKGKDSKLKTFFCTDTSRSTFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEGF
AQAGRTCISSRVYPTKAIYGAAKLFVFNNAIDATITASFKVWQMNSAFIHPYSEEAVRAL
SST
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgatgctctcttgccaatctccgccagagaagaggacccattattatcc
gccgggtcaagatccgaccctaacgcggaaacccatcgccgtagaaggcccgttaaaggt
ctcctcgccgtctcatttgggcttttgtttatcgccttttacgtcgttctcatcgccaca
cacgacggatctagtagatccaacgacgttaaaatcgaaagcgatgaaacagcgacgaca
acgtcacgtgcacgtctcgccggggtgtcggagaaaagcaatggtcagttgtggaagctt
tccggtgagcgaaatacggtgtcgttcgcttggaacaacagtgtgttgtcatggcaacga
acggcctttcattttcagcctgaacagaattggatgaacgatcctaatggtccattgttc
tacaaaggatggtaccatttcttctaccagtataatccaaacgcagccgtatggggtgat
attgtctggggtcatgccgtgtctaaggacctaatccattgggtccatttgcccatagcc
atggtagctgaccaatggtatgatgccaatggtgtctggacaggctcagccacattcctc
gatgatggctctctcgtcatgttgtacactggttccaccgacaaatccgttcaggtccaa
aatcttgcataccctgaggacctcaacgacccactcctattgaaatgggtcaagtactca
ggcaatccggttctagtacctcctcctggcattctccccaaggacttccgtgacccaacg
actgcatggaagacatcagatggaaaatggcggatcacaatcggttccaagatcaacaaa
accggaatctcactagtgtacgacacaatcgacttcaagacttacgagaaacacgacaca
ttgttgcacaaggttccaaacaccgggatgtgggagtgtgttgacttttatccagtgtct
aagaccgcggtcaatgggctcgacacatcggtcaacggaccaaatgtgaagcatatcgtg
aaggctagcatggacgacaccaggtttgatcattatgccgtggggacgtactttgattcg
aacggaacatggatcccggatgatcctactatcgatgttgggatgagtgctagtttgaga
tatgattacggaaagttctatgcttcaaagacgttttatgaccagaacaagggtcggaga
atcttgtggagttggattggtgaatctgatagtgaagctgctgatgtacaaaagggctgg
tcttctcttcagggtattccaagaaccgttgttctcgacacaaagacaggaaagaacctg
gtccaatggccagttgaagaaataaaatctcttagattaagcagcaagcaatttgatatg
gaagtcggtcccggttcagtggtaccggtcgatgtggattccgcagctcagctagacata
gaagcggagttcgagatcaataaagagtctcttgacaaaatccttggagatgcttcggtg
ctggctgaggctgaggagtttagctgccagaagagcggaggcgccagtgtccgtggtgct
ttaggaccgttcggattctcggttcttgccgacaagagcttgtcggaacaaactccggtt
tacttctatgtggctaagggaaaagattctaagctcaaaactttcttctgcacagacact
tcaaggtcaacttttgccaacgatgtcgttaaaccgatttatggtagttctgtaccggtt
cttaaaggggagaaattgaccatgagaatattggttgatcattcgatagtggaaggattc
gcacaagctggaagaacatgtatatcgtcaagggtatatccaacaaaagccatctacgga
gcagctaagctttttgtattcaacaatgccattgatgcgactattacggcgtcgttcaaa
gtctggcaaatgaacagtgcttttattcacccttactctgaggaagctgtccgtgctctc
tccagcacctga

DBGET integrated database retrieval system