KEGG   Brassica oleracea (wild cabbage): 106337713Help
Entry
106337713         CDS       T04124                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV4
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106337713
   00500 Starch and sucrose metabolism
    106337713
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106337713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
C4
AA seq 592 aa AA seqDB search
MGISNIVSVLLLLVLLSLSSNNIKGVEAFHHVYENLQSQSVESVDHLHRTAFHFQPPKHW
INDPNGPVYYKGFYHLFYQYNTKGAVWGNIVWAHSVSKDLVNWEALEHALYPSKWFDIKG
TWSGSITIVPGKGPVILYTGVNQNETQIQNYAIPKDPSDPYLRKWIKPDDNPLVMPDYTM
NGSAFRDPTTAWFSKDGHWRTVVGSKRKHRGIAYIYRSRDFKHWVKAKHPVHSKESTGMW
ECPDFFPVSTTDFQNGLDLDYTGLNTKHVLKVSLDITRFEYYTLGKYDPKKDRYVPNGDT
PDGWDGLRFDYGNFYASKTFFDYKKNRRILWGWANESDTVEDDITKGWAGLQVIPRTVLL
DANKNQLVFWPIEEIESLRTNYVRMNNKNIKMGQRLEVKGITPAQADVEVTFNVGQCLEK
AETFDPSYTFKPLDLCKIKGSNVTGGVGPFGLITLATPDLEEYTPVFFRVFKDTSTDKPK
VLMCSDARPSSLKQDRGPLKQDRMYKPSFAGFVDVDLSDGRISLRSLIDHSVVESFGALG
KTVITSRVYPLKAVKGNAHLYVFNNGTQTVNIESLDAWSMEKPLQMMNNGAL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggtatctcaaatattgtttctgtgttattattgcttgtactactcagtttaagcagt
aataacatcaaaggggttgaagcttttcatcatgtttacgaaaatttgcaatctcaatca
gtcgagtcagtggatcatcttcacagaaccgcttttcactttcaacctccaaagcattgg
attaacgatccaaatggtccagtatactacaaaggtttctaccatctcttctaccagtat
aacaccaagggtgcggtttggggcaacattgtgtgggcacattcggtctccaaagactta
gtaaattgggaggctcttgaacatgccctctatccctccaaatggtttgacattaaaggt
acatggtccggttcaataacaatcgtaccgggaaaaggaccggttatcctatataccggt
gttaaccaaaacgaaactcaaatccaaaactacgcaatcccaaaggacccctcagaccca
tacctaagaaaatggattaaaccagatgataacccgctcgtaatgccagactacaccatg
aacggttcagctttccgtgacccgaccacggcatggttctccaaagacgggcattggaga
accgtggttgggtcaaaaagaaagcatagagggattgcgtatatctacagaagccgtgat
ttcaagcattgggtcaaagctaagcacccggttcactctaaagaatcaaccggtatgtgg
gagtgtcctgatttcttcccggtttccacaactgatttccaaaacggtttggacttggat
tacaccggtttgaacaccaaacacgtgttgaaagttagcttggacataacacgcttcgag
tattacacgcttggcaaatacgatcctaagaaggaccggtacgtaccaaacggtgataca
cccgatggttgggacggtttgagattcgattatggtaacttctacgcttcaaagacattc
tttgactacaaaaagaacagaagaatcttgtggggttgggctaatgaatctgacaccgtt
gaagatgatattaccaagggctgggccggtcttcaggttattccaagaacggtgcttctt
gacgcaaacaagaatcaactagtgttttggcctattgaagaaatagagtcattaagaact
aactacgtccgaatgaacaacaaaaacatcaagatgggtcaacgcttagaagtcaaagga
atcactcctgctcaggccgatgtggaagtgacattcaacgtgggacaatgtctagagaaa
gctgaaacattcgacccgagctacacattcaaacctttagatttgtgtaaaataaaaggc
tcgaatgtgacaggtggtgttggacctttcggtttgatcacattggccactcctgatttg
gaagagtacactcctgtcttctttagagtcttcaaagacacttctacagataagcctaag
gttctcatgtgctcagatgctagaccttcatcgttgaagcaagacaggggtccactcaaa
caagataggatgtacaaaccatcatttgctgggtttgtggacgttgatctatctgatgga
aggatctctctaaggagtttgatagatcactcggtagtagagagcttcggagctttaggg
aaaacagtaataacgtcacgagtgtatccattgaaagcagtgaaagggaatgcacatttg
tatgtgtttaacaatggaacacagactgtaaacatagagagtcttgatgcatggagcatg
gagaagcctttgcagatgatgaataatggagctctctaa

DBGET integrated database retrieval system