KEGG   Brassica oleracea (wild cabbage): 106340055Help
Entry
106340055         CDS       T04124                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV2
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00052  Galactose metabolism
boe00500  Starch and sucrose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106340055
   00500 Starch and sucrose metabolism
    106340055
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106340055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 106340055
NCBI-ProteinID: XP_013634378
UniProt: A0A0D3BYG7
Position
C4
AA seq 592 aa AA seqDB search
MSASKIVSLLLLLVLINISSNDINGVNAFHKVIKKMQSKSTSLEVVSHLHRTGFHFQPPR
HWINDPNGPMVYKGIYHLFYQYNPKGAVWGNIVWAHSVSKDLINWEALEPAIYPSKWFDI
NGTWSGSATNVPGKGPVILYTGITENHTQIQNYAIPQDLSDPYLKKWIKPDDNPIVRPDH
GENGSAFRDPTTAWFNKKDGHWRMLVGSKNKRRGIAYMYKSRDFKKWVKTKRPVHTRKAT
GMWECPDFFPVSIGKKTGLDTSYDGPNTKHVLKVSLDLTRYEYYTLGTYDTKKDRYKPDG
TTPDGWDGLRLDYGNFYASKTFFDDTKNRRILWGWANESDSAVEDTLKGWAGVQLIPRTV
LLDSSGKQLVFWPIEEIESLRGKNVQMNNQKIEMGQRFEVQGITPAQVDVDVTFNVGSLD
KAETFDASFATKPLDLCNLKGSNVTGGVGPFGLITLATSDLQEYTPVFFRVFKDGTTNKP
KVLMCSDAKPSTLKGDTGTDSTEKMYKPSFAGFVDVDLADGKISLRSLIDHSVVESFGAK
GKTVITSRVYPTKAVGDNAHLFVFNNGSQPVTVESLNAWNMQKPEKMNQGAK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttcaaagattgtttctttgttactattgcttgtattaatcaatataagcagt
aatgatatcaatggcgtcaatgcatttcacaaagttatcaagaaaatgcaatctaaatca
acatcgttagaggtagtgagccatcttcacagaaccggctttcactttcaacctccacgc
cattggattaacgatccaaatggtccaatggtgtacaagggaatctaccatcttttctac
caatacaatcccaaaggtgcggtttggggtaacattgtgtgggctcattcagtttctaag
gacttgatcaattgggaagctcttgaaccggctatttacccctccaaatggtttgatatc
aatggtacatggtccggttcagccaccaacgtaccgggaaaaggaccggttatcctctac
actggtatcaccgagaaccatactcagatccaaaattatgccattccccaagacctttcc
gacccatacctcaagaaatggatcaagcccgacgacaaccctatcgtaagacccgaccat
ggcgagaatggatccgctttccgtgacccgacaactgcttggttcaacaaaaaagatggg
cactggagaatgcttgtgggctcaaagaacaagcgtagaggaattgcttatatgtacaaa
agtcgtgacttcaagaaatgggtcaaaactaaacgtcccgtacacactagaaaagcaacc
ggtatgtgggaatgtcccgactttttcccggtttccatcggcaagaaaaccggtttagac
accagctatgacggtccaaacaccaagcatgtgttgaaggttagcttggacctgaccagg
tacgagtactacactcttggaacgtatgatactaagaaggatcgttacaagcctgatggt
accactcctgatggttgggatggtttgagactagattatggtaacttctatgcgtcaaag
acattctttgatgacacgaagaacagaagaatcctctggggttgggctaatgaatctgat
agtgctgtggaagataccttgaagggttgggccggtgttcagcttatcccaagaacggtc
ttgcttgactctagtggtaagcaactcgtgttttggcctattgaagaaatcgagtcgttg
agaggaaagaatgttcaaatgaacaaccagaaaatagaaatgggtcaacgctttgaggtc
caagggatcaccccggcccaggttgatgtggatgtgacattcaacgtaggaagtctagac
aaggcagaaacatttgacgcgagttttgcaacaaaaccactagatttatgtaatttgaag
ggttcaaatgtgactggtggggttggcccttttggtctgatcaccttggctacgtctgac
ctacaagaatacactcccgtcttcttcagagtcttcaaagatggcacaaccaacaagcct
aaggtcctcatgtgctctgatgccaagccttcaactctcaaaggagacacgggcactgac
tccacggagaagatgtacaaaccctcgtttgctggttttgtcgatgttgatctcgccgac
ggaaagatatctttaaggagtttgattgatcactcggtcgtggaaagctttggagcaaaa
ggaaagacagtgataacatctcgagtgtatcctaccaaagctgtaggtgacaacgctcat
ttgtttgtcttcaacaatgggtcacagcctgtgactgttgagagcctcaacgcatggaac
atgcagaagcccgagaaaatgaaccaaggagctaaatga

DBGET integrated database retrieval system