KEGG   Brucella canis Oliveri: BCOUA_II0005Help
Entry
BCOUA_II0005      CDS       T03030                                 

Definition
unnamed protein product
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bol  Brucella canis Oliveri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bol00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCOUA_II0005
Enzymes [BR:bol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BCOUA_II0005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
II:2092..3033
Genome map
AA seq 313 aa AA seqDB search
MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGGKGANQAVAVAKLGGA
IRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGAN
ARWSSADINAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMA
DLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLVTAD
EVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYGSAAGAIAVTRVGAGAAA
PTAREVEELIGRA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagccatggagaagccccgttgaagattttcgttttcggcagtgtgaatgtggatgta
agcgcccgaatggctgccctgccgcggccggggcagacggtaaacgcatccggctatggc
atcgggctgggtggcaaaggagccaatcaggcggttgcggtggcaaaacttggcggggca
atccgatttgtcggcgcggtcggccatgatgcctttggcgaactggccttaaagcagatg
cgcgagtttgggctggataccggcagcgtgcgcgtgatcgatgacgtcgatacaggcatg
gcgatcatccaggtggaggaaaccgggcagaacacgattgcggtctgtgctggcgccaat
gcgcgctggtcgtcagccgatattaatgcttatggcgctgatattgccaaggcaaggatt
acgcttttgcagcgcgaagtgccgcatgaagccaatctggccgttgcgaaagccgtgcgg
gcagcgggtggaaccgtcctgctcgacccggccccggtgggggatgcaagccagatggcc
gatcttatcgccctgagcgacatcatttcgcccaacgagacggaagccgctgaaatcacc
ggcattgagccgaccgacctcgcttcggcggaagcggcggggcgcaagcttctggagcgc
ggcccgaagatcgtcatcctcaagcttggaagccgtggcgcgctgctggtaacggcggat
gaggtgaaacacttcacgccgttcaaggtaaaggtggtggatacggttgcagccggtgac
agtttcaacggcggctttgccgttgctttctcgcaggcgcggcccttgcatgattgcgtg
cggtatggttcggcggcgggcgcgattgcggttacgcgggttggcgcaggcgctgccgcg
ccaaccgcgcgtgaggttgaggaactcatcgggcgcgcttga

DBGET integrated database retrieval system