KEGG   Bos mutus (wild yak): 102264416Help
Entry
102264416         CDS       T02919                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102264416 (ART4)
Cellular antigens [BR:bom04090]
 Proteins
  102264416 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 327 aa AA seqDB search
MELRGQRNALHTDKCCPLTNHCRRILLANTAASAVRIWLLRGQLLLLLLCSGLQRPTEAG
KIAVKIDFDLTPNSFDDQYRGCSQQVMEMLLQGDYFMEELESSKHYRKVWHQTHLNWLNQ
EKPLPGNMTVTHALAVSVYLSDDRVHLDFSRAMASAAGSPQQYKHSFRFKYLHYFLTSAI
QLLRKEIVSRKDSLCYEVQHELKGVYLRAPVGAIVRFGQFLSTSPAREQAQRFGNQTLFT
MLTCLGAPVQDFSLKKEVLVPPYELFKVVNVSYHPRGNWLQLLSNGTQSTYNCQLLKASS
RKCIPTPLVVASLSFLTSVIIFSKSGA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgagggcaaagaaacgctctgcacacagacaaatgctgtcccctgaccaat
cattgcagaaggattcttctggcaaatactgcagcctctgcggtgagaatctggctcctg
agggggcagcttcttctcctgctgttgtgctctggtctgcagagacccacggaggcaggt
aagattgcagttaaaatcgactttgacttgacaccaaattcctttgatgatcagtaccga
ggctgcagccaacaagtcatggagatgctgcttcaaggggattatttcatggaagaacta
gaatccagtaagcattaccgcaaggtctggcaccaaacacacttaaactggttgaaccaa
gaaaaacctctccccgggaacatgactgttacacatgctctggctgtctcggtttattta
tcagacgacagagttcacttagacttctccagagccatggccagtgctgctgggtctccg
cagcagtataaacattcattccgtttcaaatatctacactacttcctgacctcagcaatc
cagctgctgaggaaagagattgtctcgaggaaagactctctgtgttacgaggtgcagcat
gagttgaagggcgtttacttgcgagcccccgtgggtgcgatcgttcgctttggccaattc
ctctccacctccccagcaagagaacaggcacagaggtttgggaaccaaactctgtttacc
atgttgacctgcctgggggcaccagtacaagacttctctctcaagaaggaggtcttggtc
cctccctatgagctgtttaaagttgtcaatgtgagctaccatccaagaggaaattggttg
caattgctgtcaaatgggacccaaagcacgtacaactgtcagctgctaaaagcttccagc
agaaagtgcatccctactcctctggttgttgcttctctctcctttttgaccagtgtcatc
atcttttccaaaagtggagcataa

DBGET integrated database retrieval system