KEGG   Bos mutus (wild yak): 102264967Help
Entry
102264967         CDS       T02919                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
bom  Bos mutus (wild yak)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:bom00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102264967 (ABHD6)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102264967 (ABHD6)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S33
   102264967 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLALPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVRHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSMVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGHVAGVYAAHYPSDVCSLSLVCPAGLQYST
DNKFVQRLKELQESAAVEKIPLIPTTPKEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
TFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANSQVEL
LENCGHSVVMERPRKTAKLLVDFLASVHSTDNSKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgacgtggttaacatgtttgtgatcgcgggcgggacgctggccctgccgatc
ctggcattcgtagcctcttttctcctgtggccttcagccctgataagaatctattactgg
tactggcggaggacgctgggcatgcaggtccgctatgtgcgccatgaagactatcagttc
tgctactccttccgtggcaggcctggccacaaaccttccatcctcatgctccacgggttc
tctgcccacaaggacatgtggctcagcatggtcaagttcctcccgaagaacctgcacctg
gtctgcgtggacatgccagggcatgagggcaccacccggtcctcactggatgacctgtcc
atagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaag
cccttccacctggtaggcacctccatgggcggccacgtggctggggtgtatgctgctcac
tacccatcagacgtctgcagcctgtcccttgtgtgtcctgcaggtctgcagtactcaact
gataacaaatttgtgcaacggctcaaagaactgcaggagtcggccgccgtagagaagatt
cccttgatcccgaccaccccgaaggagatgagtgagatgctgcagctctgctcctacgta
cgcttcaaggtgccccagcagatcctgcagggccttgttgatgtccgcatccctcacaac
accttctaccgaaagctgtttttggaaatcgtcagtgagaagtcgagatactccctccat
cagaacatggacaagattaaggtccccacgcagatcatctgggggaaacaagaccaggtg
ctcgatgtgtccggggcagacatgttggccaagtcaatcgccaactcccaggtggagctc
ctggaaaactgtgggcactcagtggtgatggagaggcccaggaagacagccaagctcctt
gttgacttcttggcttctgtacacagcacagacaacagcaagaagctggactga

DBGET integrated database retrieval system