KEGG   Bos mutus (wild yak): 102265495Help
Entry
102265495         CDS       T02919                                 

Definition
(RefSeq) ecto-ADP-ribosyltransferase 5
  KO
K19977  
ADP-ribosyltransferase 5 [EC:2.4.2.31]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102265495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 269 aa AA seqDB search
MLAALLIALSCLSLHTLGSSVRPSVPWQNISIQNLSLAPDTFDDAYVGCSEEMEEKAVLL
LEKEMADHALLRESWETAQKAWEKKRPGLTLPPGFRSQHGIAIIVYTSSPNALYWELNQA
VRTGGGSWESYMKHFPFKALHFYLTRALQLLRGGGGCSREPGQVVFRGVGTIRFEPKSVG
DSIRLGQFTSSSLDETVAHGFGNATFFSIRTCFGVPIQTLSVFPEEHEVLIPPQEVFVVT
GFSKDGNKHLVNLSSNNQICSHFNCAYLG
NT seq 808 nt NT seq  +upstreamnt  +downstreamnt
atgttggcagctctgctgatcgccctcagctgccttagcctccacaccctcggcagcagt
gtccgcccgtctgtcccctggcagaatatttccatccagaacctgagcctggctccagac
acattcgatgatgcctatgtgggctgctcggaggagatggaggagaaagcggtgcttctg
ttagagaaggagatggccgaccatgccctgctgcgagagtcctgggagacagcccagaag
gcctgggagaaaaaacgtccagggctcactctgcctcctggcttcagaagccagcacgga
attgccatcatagtctacaccagctcacccaacgctttgtactgggagctgaaccaggct
gtgcggactggcggtggctcctgggagtcctacatgaagcacttccctttcaaggctctg
catttctacctgacccgggccctgcagctgcttcggggtggtgggggctgcagcagggaa
cctgggcaggtggtgttccgtggtgtgggcaccattcgctttgaacctaagagtgtgggg
gactctatccgcttgggccagtttacctccagttccctggatgagacagtggcccacggc
tttggtaatgccaccttcttctctataaggacttgctttggggtccccatccagacactg
tctgtctttcctgaggagcatgaggtgctgatccccccgcaagaagtcttcgtggtgacg
ggtttctccaaggatggaaacaaacacctggtgaatctctccagcaataatcagatctgc
agccactttaactgcgcctatctgggtg

DBGET integrated database retrieval system