KEGG   Bos mutus (wild yak): 102265599Help
Entry
102265599         CDS       T02919                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102265599 (CTRB1)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102265599 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 284 aa AA seqDB search
MALLWVVLGFFLFGSSFGCGVPAIDPVLSGLSRIVNGEDAVPGSWPWQVSLQTSSGFHFC
GGSLISEDWVVTAAHCGVRKGHLVVAGVSDQGSEEEAGQVLRVAEVFEHPQWDLRAVRND
VALLKLAAPARLSAAVAPVCLPSADTSFPTGSLCTVTGWGKTRYNAFDTPDKLQQATLPI
LSNADCREFWGSKITDVMICAGASGISSCMCPSEGVDQHYQRPLVRAGSDQGDSGGPLVC
QKDGAWTLAGIVSWGSSRCSPFLPGVYARVTKFIPWILEVLEAN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcccttctctgggttgtccttggcttcttcctctttggcagcagcttcggttgcggg
gtccccgccatcgaccctgtgctgagtggcctctccaggattgtcaatggggaggacgct
gtgcccggctcctggccctggcaggtgtccctgcagaccagctccggcttccacttctgc
gggggctccctcatcagtgaggactgggtggtcaccgctgcccactgtggggtcaggaag
ggtcacctcgtggtggccggggtgtccgaccagggctccgaggaggaggccggccaggtg
ctgagggtcgccgaggtcttcgaacacccgcagtgggacctgcgcgccgtgcgcaacgac
gtggccctgctgaagctggcggcgcccgcccgcctctccgcagccgtggcccccgtctgc
ctgcccagcgccgacaccagcttccccacgggctccctgtgcaccgtcaccggctggggc
aagacccggtacaacgcctttgatacccctgacaagctgcagcaggccaccctgcccatt
ctgtctaatgccgactgcagagagttctggggcagcaagatcaccgacgtgatgatctgt
gcaggggccagcggcatctcctcctgcatgtgccccagtgaaggcgtggaccagcactat
cagaggcccctggtgagagctggttctgaccagggcgactcaggtggccccctggtctgc
cagaaggacggggcctggaccctggcgggcatcgtgtcctggggcagcagccggtgtagc
ccattcttacctggcgtgtatgctcgggtcaccaagttcattccctggattcttgaagtt
ctggaggccaactga

DBGET integrated database retrieval system