KEGG   Bos mutus (wild yak): 102266201Help
Entry
102266201         CDS       T02919                                 

Gene name
RNASE1
Definition
ribonuclease, RNase A family, 1 (pancreatic)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
bom  Bos mutus (wild yak)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 150 aa AA seqDB search
MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSSASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtccctggtcctgttgtcgctgttagtcctggtgctgctgctggtgcgg
gtccagccttccctgggcaaggaaactgcagcagccaagtttgagcggcagcacatggac
tccagcacttcctctgccagcagctccaactactgtaaccagatgatgaagagccggaac
ctgaccaaagatcgatgcaagccagtgaacacctttgtgcacgagtccctggctgatgtt
caggctgtgtgctcccagaaaaatgttgcctgcaagaatgggcagaccaattgctaccag
agctactccaccatgagcatcacagactgccgtgagaccggcagctccaagtaccccaac
tgtgcctacaagaccacccaggcgaataaacacatcattgtggcttgtgagggaaacccg
tacgtgccagtccactttgatgcttcagtgtag

DBGET integrated database retrieval system