KEGG   Bos mutus (wild yak): 102266770Help
Entry
102266770         CDS       T02919                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
bom  Bos mutus (wild yak)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102266770
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102266770
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102266770
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102266770
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102266770
  Exosomal proteins of breast milk
   102266770
Heparan sulfate/heparin binding proteins [BR:bom00536]
 Enzymes (General comment) Variety
  102266770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MESKALLLLALSVCLQSLTVSRGGLVAADRITGGKDFRDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGQDVAKFMNWMADEFNYPLGNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEVDIGELLMLKLKWISDSYFSW
SNWWSSPGFDIGKIRVKAGETQKKVIFCSREKMSYLQKGKSPVIFVKCHDKSLNRKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaggccctacttctgctggctctgagcgtgtgcctgcagagtctgaccgtc
tcccgcggagggctggtcgccgcagacaggattacaggaggaaaagattttagagacatt
gaaagtaaatttgctctcaggactcctgaagacacagctgaggacacttgccacctcatt
cctggagtgaccgaatctgtggctaactgtcacttcaaccacagcagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaactcgtggct
gccttgtacaagagggaaccggactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggacaggatgtggccaag
tttatgaactggatggcggatgaatttaactatcccctgggcaatgtgcatctcttggga
tacagccttggggcccatgctgctggtattgcaggaagtctgaccaataagaaggtcaac
aggataaccggcttagatccagctggacctaacttcgagtatgcagaagctccaagtcgc
ctttctcctgatgatgcggattttgtagacgttttacacacattcaccagggggtcacca
ggtcgaagtatcggaatccagaaaccagtagggcatgtggacatttaccctaacggaggc
actttccaaccaggatgtaacattggggaagctctccgtgtgattgcagagagaggcctt
ggagatgtggatcagctagtgaagtgctcccatgagcgttccgttcatctcttcattgac
tctctgttgaatgaagaaaatccaagtaaggcctaccggtgcaattccaaagaagccttt
gagaaaggtctctgcctgagctgcagaaagaaccgttgcaacaacatgggctacgagatc
aacaaggtcagagccaaaagaagcagcaagatgtacctgaagactcgttctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctggaactgagagtaatacatac
accaaccaggccttcgagatctctctgtatggcactgtggctgagagcgagaacatccct
tttaccctgcctgaagtttccacaaataagacatactcctttctactttacacggaggtg
gatattggagaattgctaatgttgaaactcaaatggattagcgattcctacttcagctgg
tccaactggtggagcagccccggctttgatattgggaagatcagagtaaaggcaggagag
actcaaaaaaaggtgatcttctgttcccgggagaaaatgtcttatctgcagaaaggaaag
tcacctgtgatatttgtgaaatgccatgacaagtctctgaatagaaagtctggctga

DBGET integrated database retrieval system