KEGG   Bos mutus (wild yak): 102266770Help
Entry
102266770         CDS       T02919                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00561  Glycerolipid metabolism
bom01100  Metabolic pathways
bom03320  PPAR signaling pathway
bom04979  Cholesterol metabolism
bom05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102266770 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102266770 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102266770 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102266770 (LPL)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102266770 (LPL)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102266770 (LPL)
  Exosomal proteins of breast milk
   102266770 (LPL)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102266770 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Enzymes
  102266770 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 102266770
NCBI-ProteinID: XP_005902365
UniProt: L8I8U2
Position
Un
AA seq 478 aa AA seqDB search
MESKALLLLALSVCLQSLTVSRGGLVAADRITGGKDFRDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGQDVAKFMNWMADEFNYPLGNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEVDIGELLMLKLKWISDSYFSW
SNWWSSPGFDIGKIRVKAGETQKKVIFCSREKMSYLQKGKSPVIFVKCHDKSLNRKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaggccctacttctgctggctctgagcgtgtgcctgcagagtctgaccgtc
tcccgcggagggctggtcgccgcagacaggattacaggaggaaaagattttagagacatt
gaaagtaaatttgctctcaggactcctgaagacacagctgaggacacttgccacctcatt
cctggagtgaccgaatctgtggctaactgtcacttcaaccacagcagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaactcgtggct
gccttgtacaagagggaaccggactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggacaggatgtggccaag
tttatgaactggatggcggatgaatttaactatcccctgggcaatgtgcatctcttggga
tacagccttggggcccatgctgctggtattgcaggaagtctgaccaataagaaggtcaac
aggataaccggcttagatccagctggacctaacttcgagtatgcagaagctccaagtcgc
ctttctcctgatgatgcggattttgtagacgttttacacacattcaccagggggtcacca
ggtcgaagtatcggaatccagaaaccagtagggcatgtggacatttaccctaacggaggc
actttccaaccaggatgtaacattggggaagctctccgtgtgattgcagagagaggcctt
ggagatgtggatcagctagtgaagtgctcccatgagcgttccgttcatctcttcattgac
tctctgttgaatgaagaaaatccaagtaaggcctaccggtgcaattccaaagaagccttt
gagaaaggtctctgcctgagctgcagaaagaaccgttgcaacaacatgggctacgagatc
aacaaggtcagagccaaaagaagcagcaagatgtacctgaagactcgttctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctggaactgagagtaatacatac
accaaccaggccttcgagatctctctgtatggcactgtggctgagagcgagaacatccct
tttaccctgcctgaagtttccacaaataagacatactcctttctactttacacggaggtg
gatattggagaattgctaatgttgaaactcaaatggattagcgattcctacttcagctgg
tccaactggtggagcagccccggctttgatattgggaagatcagagtaaaggcaggagag
actcaaaaaaaggtgatcttctgttcccgggagaaaatgtcttatctgcagaaaggaaag
tcacctgtgatatttgtgaaatgccatgacaagtctctgaatagaaagtctggctga

DBGET integrated database retrieval system